KEGG   Bifidobacterium bifidum BGN4: BBB_0927Help
Entry
BBB_0927          CDS       T02135                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBB_0927 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBB_0927 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BBB_0927 (trpB)
Enzymes [BR:bbf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BBB_0927 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1114060..1116147)
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRSRECVVSLEDVRRAALATPAPIDATRWLKRPDGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYERGGASAISVLTEGRRFLGSLDDFDKVRSAVHIPLLRKDFI
VTDYQIYEARAHGADLVLLIVAALDDDKLAHLLELAHELGMAVLVETHTTEEIRRAVAAG
ARIIGINARNLKNLKVDVNKYAELAEGLPDDVIRVAESGVFGSVEVEDYGRAGADAVLVG
EGVATADDHVAAVQRLVKAGQRVKASESTPLSEHQGPYWGQFGGRYVPEALITALDELER
IYDQAKADPEFRKEFMTLQQRYVGRPSPLTEAPRFAALVKDRTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRVYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVADTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAVCACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPA
SGHHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKEIGR
VNYSWATDEEAMNAFRDLSQTEGIIPAIESSHAVAGAFKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDEQAAALDVTGAQGDTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaattggttgccggggcgttggaagaccagcgttcccgcgaatgt
gtcgtgtctcttgaggatgtgaggcgggccgctctggccacgccggcgcctatcgacgcg
acgcgatggctcaagcgtccggacggcatccccgtgatcgccgaaatcaagcgcgcctcc
ccatccaaggggcatttgagcgatatccccgacccggcggccctggcccgcgaatacgag
cgcggcggtgcgagcgcgatttccgtgctcaccgaaggccggcggttcctcggctcactg
gacgatttcgacaaggtccgctcggcggttcacattccgctgctgcgcaaggacttcatc
gtcaccgactaccagatctacgaggcgcgtgcccacggcgccgacctagtgctgctcatc
gtcgccgcgctggacgacgacaagctcgcgcacctgcttgaactcgcccacgagctcggc
atggccgtgctcgtcgaaacgcacaccaccgaggagatccgccgcgcggtcgcggccggc
gcccggatcatcggcatcaacgcgcgcaatctcaagaacctgaaggttgacgtgaacaaa
tacgccgaactcgccgaaggactgcccgatgacgtgatccgcgtcgcagagtcgggcgtg
ttcggttcggtcgaggttgaggattacggtcgcgccggcgcggatgccgtgctggtgggc
gaaggcgtggccaccgccgacgaccatgtggccgccgtacaacgactagtaaaggcaggt
cagagagtgaaagcatccgaatcgaccccgttgagcgagcatcagggaccatattgggga
cagttcggcgggcgatacgtgccggaggcgctgatcaccgctctggacgagctggagcgc
atctatgatcaggccaaggccgaccccgagttccgtaaggaattcatgacgctgcagcag
cggtacgtcggccgcccgagcccgctgacggaagccccgcgattcgccgcgctggtcaag
gacaggaccggactcgacgcccgcatcttcttgaagcgcgaagacctcaaccacaccggc
gcgcacaagatcaacaacgcgctcggtcaggcgttgctcgtcaagcgcatgggcaagacc
cgcgtgatcgccgagaccggtgccggacagcacggcgtggccaccgccaccgtgtgcgcg
atgctagggctcaagtgccgcgtgtacatggggcagatcgacgcccgacgccaggccctc
aacgtggcccgcatgcgcatgctgggcgccgaggtcgtcgaagtgacactgggcgacaag
attctcaaggatgcaatcaacgaggcgctgcgcgattgggtgaccaacgtcgccgatacg
cactacctgctcggcacggtcgccggaccgcacccgttcccggccatggttcgcgacttc
cagaagatcatcggcgaggaggccaagcagcaacttcaggactggtacggcatcgaccac
ccggacgcggtgtgcgcgtgcgtcggcggcggatccaacgccatcggcgtgatgaacgcg
ttcctcgacgacgagcgcgtgaacctgtacggctatgaggcgggcggcaacgggccggcc
tcgggccatcatgcgatccgtttcgcaccgggcaccggacagctcggcatgttccagggt
gccaagagctacctgttggagaccgatgaaggacagactctcgacacgtattcgatttcg
gccggtctcgattacgcttccgtcggccccgagcacgcttggctcaaggagatcgggcgc
gtgaactactcctgggccaccgacgaggaggctatgaacgccttccgcgacctgagccag
accgagggcatcatccccgccatcgagagctcgcatgccgtcgctggcgccttcaaggcc
gccgctgatctgaaggccaagggatacgacaaggccgtgatgatcgtcaacatctccggc
cgcggcgacaaggacatggccaccgcgggcaaatggttcggatacctgaccgacgagcag
gccgcggcgctcgatgtcaccggcgcgcagggcgacaccgtcgcctga

DBGET integrated database retrieval system