KEGG   Bifidobacterium bifidum BGN4: BBB_0939Help
Entry
BBB_0939          CDS       T02135                                 

Gene name
ruvA
Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BBB_0939 (ruvA)
Enzymes [BR:bbf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BBB_0939 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1128016..1128633)
Genome map
AA seq 205 aa AA seqDB search
MISTLTGRVESVEASSAVIEVHGVGYEVRMAAADLAALHAGQETHVFTSLTISQDAVTLF
GFLSPASKRMFLQLQKVSGIGPKVALSLLSTLPPDRLAKAVADGDTAALSKAPGLGKKGA
QKIILELAGRIDLDQIRPEADGPSESRDPGARQVIEGLVSLGWRPQTAEEAVRQACDAAS
IATPISAEDVPRVLKLALSSLDRGR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtacgttaaccgggcgcgtcgagtcggtggaggcatccagcgccgtgatcgag
gttcatggcgtcgggtacgaggtccgcatggcggcggccgatcttgcggcgttgcatgcc
ggtcaggaaacacacgtcttcacttcgctgaccatatcgcaggatgccgtcaccctgttc
gggttcctgtcacccgcgtccaaacgcatgttcctgcaattgcagaaggtcagtggcatc
gggccgaaggtcgcgctttccctgttgtcgacgctacctccggaccgtctggccaaggcc
gtcgcggacggcgacacggcggcattgtccaaggctccgggcctgggcaaaaaaggcgca
cagaagatcatccttgaactggcaggccgcatcgacctcgaccagatacggcccgaagcc
gatgggccgtcggaaagtcgcgaccccggagccaggcaggtgatcgaaggactcgtctct
ctgggatggcgcccccagaccgcggaggaggccgtacgtcaggcatgcgatgccgcgtcc
atagccacccccatcagtgcggaggacgtgccgcgggtgctcaaactggcattgtcgtcg
ctggacagaggaaggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system