KEGG   Bifidobacterium bifidum BGN4: BBB_0962Help
Entry
BBB_0962          CDS       T02135                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBB_0962 (tpiA)
   01230 Biosynthesis of amino acids
    BBB_0962 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBB_0962 (tpiA)
   00051 Fructose and mannose metabolism
    BBB_0962 (tpiA)
   00562 Inositol phosphate metabolism
    BBB_0962 (tpiA)
Enzymes [BR:bbf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BBB_0962 (tpiA)
Exosome [BR:bbf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BBB_0962 (tpiA)
  Exosomal proteins of bladder cancer cells
   BBB_0962 (tpiA)
  Exosomal proteins of melanoma cells
   BBB_0962 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157005..1157799)
Genome map
AA seq 264 aa AA seqDB search
MASRIPLLAGNWKMNLDHLEATYFVQKLVWLLRDARFDYSRCEIALMPSFTSLRSVQVLV
EADKLKIRYGAQAVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDVNIVDQ
VRAVLAAGMQPILCVGESFEERRQGIELDFAVGQVHDVTRDLSDKEAAKLIIAYEPVWAI
GTGMVATPDTAQQAAKAIRDDLGEMFGPAVADTVRILYGGSVSSKNATHLIGEPDVDGFL
IGGASLDPDELAKIARLTLKATRR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacgcatcccgctgctcgcgggcaattggaagatgaacctcgaccatcttgag
gccacgtatttcgtgcagaaactcgtatggctgcttcgtgacgcacgcttcgactactcc
cgttgcgaaatagccctgatgccgtcgttcacgtcgctgcgcagcgtccaggtgctggtc
gaagccgacaagctcaagatccgctacggcgcgcaggccgtgtcggtgaccacacagggt
gcgttcaccggcgatgtctccgctgacatgatcgcgcacctcggctgctcgtacgtcatc
gtcgggcattccgaacgccgcaagtaccatcccgaagacgacgtcaacatcgtcgatcag
gtgcgtgccgtattggcggccggcatgcagccgatactgtgcgtcggagaaagcttcgag
gaacgccgtcagggcatcgagctcgactttgccgtcggacaggtgcatgacgtgacccgt
gacctttccgacaaggaggccgcgaagctcatcatcgcgtacgagccggtctgggcgatc
ggcaccggcatggtcgccactccggacaccgcccagcaggccgccaaagccatccgcgac
gacctcggcgagatgttcggccccgccgtcgccgatactgtgcgcatcctatacggcgga
tcggtgtcgtccaagaacgcgacgcatctgatcggcgagccggatgtcgacggattcctg
atcggcggcgcgtcgctcgaccccgacgaattggcgaagatcgcccggttgacactcaag
gcgacacgtcgatag

DBGET integrated database retrieval system