KEGG   Bifidobacterium bifidum BGN4: BBB_1017Help
Entry
BBB_1017          CDS       T02135                                 

Gene name
gpmB
Definition
putative phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBB_1017 (gpmB)
   01230 Biosynthesis of amino acids
    BBB_1017 (gpmB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBB_1017 (gpmB)
  Energy metabolism
   00680 Methane metabolism
    BBB_1017 (gpmB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBB_1017 (gpmB)
Enzymes [BR:bbf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BBB_1017 (gpmB)
Exosome [BR:bbf04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BBB_1017 (gpmB)
  Exosomal proteins of melanoma cells
   BBB_1017 (gpmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1220903..1221739)
Genome map
AA seq 278 aa AA seqDB search
MIDEVVFLRHGRTAFNVARRLQGQIDVPLDVIGQWQADQSASELARRYYWAKVANIARHP
DTLAQPGPGAAKSSDIEDYRQVPASSRRMVVVSSDLFRALQTAHAFADMLGLDVTADARL
RERSFGQWEGMTRDEIRAEHADAYDSWRIHTGGELAFGVESRIATGLRGADAVLDLVRGI
NAEHADEPTTLMLVGHGSWHVATIETLLGMDPDNLSNLDGMRNAFWSTLRPVYRPSGGVE
WMMTAFNQGPAVAALCDWENGPQSLHGPHMPMWKPIEG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattgacgaagtggtgtttctgcggcacggacggaccgccttcaatgtggcgaggcgg
ttgcaggggcagatcgacgtgcccctcgacgtcatcggccagtggcaggccgaccagagc
gcgtcggagcttgcgcgacgctactactgggcgaaggtggccaacatcgcccggcatccg
gatacgctggcccagccggggccgggggcggcgaaatccagcgacatcgaggactaccgg
caggtccccgcatcctcgcgacgcatggtcgtcgtctcgtccgacctgttccgtgcgttg
cagaccgcgcacgcgttcgccgatatgctgggactggacgtgaccgcggacgcgcgcctg
cgcgaacgcagcttcgggcagtgggagggcatgacccgcgacgagattcgagcggagcat
gccgacgcctatgattcgtggcggatccacaccggcggcgagctcgcgttcggcgtggag
agccgcatcgccacaggactgcgcggcgccgatgcggtgctcgacctggtgcgcggcatc
aacgcggagcatgccgatgagccgaccaccctgatgctcgtcgggcacggctcatggcat
gtggccacgatcgagaccctgctcggcatggaccccgacaacctgagcaacctggatggc
atgcgcaacgcgttctggtcgacgctcagaccggtataccggccttcgggcggcgtcgaa
tggatgatgacggcgttcaaccaggggccggcggtcgctgctctgtgcgattgggagaac
ggcccgcagtccctgcacggcccgcacatgccgatgtggaagccgatcgaggggtga

DBGET integrated database retrieval system