KEGG   Bifidobacterium bifidum BGN4: BBB_1057Help
Entry
BBB_1057          CDS       T02135                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BBB_1057 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BBB_1057 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BBB_1057 (thrC)
Enzymes [BR:bbf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BBB_1057 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258995..1260482
Genome map
AA seq 495 aa AA seqDB search
MTTFHSTRSTTDSLTSKQAIRKGIADDGGLFVTDSLGETKVDIASLTGKPYQQIAAEVLG
ALLPDFTEAELAQCIADAYGEQWSDRRITPLKPLGDDYILELFNGPTSAFKDVALQILPR
FMAHTTPADGDTDEKIMILTATSGDTGKAALAGFADAPGTAITVFYPQGKVSQVQELQMS
TQAGANVNVCAVEGNFDDAQSAVKRIFGDKELAAKLAADSHVVLSSANSINVGRLVPQVV
YYFSAYAQLLENQVINVGDEVEFVVPTGNFGDILAGYYAKMLGLPVKHLVVASDKNNVLF
DFLTTGTYNRQRPFFQTISPSMDILISSNLERMLYYMSEGDTRLISMLMNDLSQWGTYEV
PEPLLAKIRQLFGCGWADENQVREMIADCWKKNRYVIDPHTACAYFVAQQMPRDPLTPRV
ILSTASPYKFPRVVNEALGLDADGTDFECMDVLSRETGTTAPAALHGLETAGVRFKDVVP
IDGMEDYVEKAAQAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacgttccacagcacgcgcagcaccaccgactcacttacctccaagcaggccatc
cgcaagggcatcgccgacgacggcggcctgttcgtgaccgattccctgggcgagacgaag
gtggacatcgcttccctgacaggcaagccgtatcagcagatcgccgccgaggtgctcggt
gcgctgctgccggacttcaccgaggccgagctcgcgcagtgcatcgccgacgcttacggc
gagcagtggtccgacaggcgcatcacgcccctgaagccgctcggcgacgactacatcctc
gaactgttcaacggcccgacctccgcgttcaaggacgttgcgctgcagatcctcccccgt
ttcatggcgcacacgacgccggcggacggcgacaccgacgagaagatcatgatcctgacc
gccacctccggcgacaccggcaaggccgcgctggccggattcgcagacgcgcccggcacc
gcgatcaccgtcttctacccgcagggcaaggtgagccaggttcaggagctgcagatgagc
acgcaggccggcgcgaacgtgaacgtgtgcgcggtcgagggcaacttcgacgacgcgcag
tccgccgtcaagcgcatcttcggcgacaaggagctcgccgcgaagctcgccgccgactcg
cacgtcgtgctctcctccgcgaactccatcaacgtgggccgtctcgtaccgcaggtcgtc
tactacttctccgcttacgcgcagctgctggagaaccaagtcatcaacgtgggcgacgag
gtcgagttcgtcgttccgaccggcaacttcggcgacatcctcgccggctactacgcgaag
atgctcggtctgccggtcaagcacctcgtggtcgcctccgacaagaacaacgtgctgttc
gacttcctgaccaccggcacgtacaaccgtcagcgtccgttcttccagacgatcagcccg
tcgatggacatcctcatctcctcgaacctggagcgcatgctgtactacatgtccgagggc
gacacccgtctgatctccatgctgatgaatgacctcagccagtggggcacgtacgaggtt
ccggagccgctgctcgcgaagatccgccagctgttcggctgcggctgggccgacgagaac
caggtgcgtgagatgatcgccgactgctggaagaagaaccgctacgtgatcgacccgcac
acggcgtgcgcgtacttcgtggctcagcaaatgccgcgcgacccgttgaccccgcgcgtg
atcctgtcgactgcgagcccctacaagttcccgcgcgtggtcaacgaggcactgggcctg
gatgccgacggcaccgatttcgaatgcatggatgtgctgtctcgcgagaccggcaccacc
gctccggccgccctgcatggacttgagaccgccggtgtacgtttcaaggacgtcgtgccc
atcgacggcatggaggattacgtcgaaaaggccgcccaagcgctgtaa

DBGET integrated database retrieval system