KEGG   Bifidobacterium bifidum BGN4: BBB_1337Help
Entry
BBB_1337          CDS       T02135                                 

Gene name
bgaB
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BBB_1337 (bgaB)
Enzymes [BR:bbf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BBB_1337 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1595246..1597315)
Genome map
AA seq 689 aa AA seqDB search
MSKRRKHSWPQPLKGAESRLWYGGDYNPDQWPEEVWDDDIRLMKKAGVNLVSVGIFSWAK
IEPEEGKYDFDWLDRAIDKLGKAGIAVDLASATASPPMWLTQAHPEVLWKDERGDTVWPG
AREHWRPTSPVFREYALNLCRRMAEHYKGNPYVVAWHVSNEYGCHNRFDYSDDAMRAFQK
WCKKRYKTIDAVNEAWGTAFWAQHMNDFSEIIPPRYIGDGNFMNPGKLLDYKRFSSDALK
ELYIAERDVLESITPGLPLTTNFMVSAGGSMLDYDDWGAEVDFVSNDHYFTPGEAHFDEV
AYAASLMDGISRKEPWFQMEHSTSAVNWRPINYRAEPGSVVRDSLAQVAMGADAICYFQW
RQSKAGAEKWHSSMVPHAGEDSQIFRDVCELGADLGRLSDEGLMGTKTVKSKVAVVFDYE
SQWATEYTANPTQQVDHWTEPLDWFRALADNGITADVVPVRSDWDSYEIAVLPCVYLLSE
ETSRRVREFVANGGKLFVTYYTGLSDENDHIWLGGYPGSIRDVVGVRVEEFAPMGNDMPG
ALDHLDLDNGTVAHDFADVITSTADTSTVLASYKAERWTGMNEVPAIVANGYGDGRTVYV
GCRLGRQGLAKSLPAMLGSMGLSDLAGDGRVLRVERADAAAASHFEFVFNRTHEPVTVDV
EGEAIAASLAHVDDGRATIDPTGVVVLRR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgcagaaagcacagttggccgcagccgctgaagggcgccgaatcccgtctc
tggtatggcggtgattacaatcccgaccaatggccggaggaggtctgggacgatgatatc
cgtctgatgaagaaggccggcgtcaaccttgtatcagtcggcatcttctcatgggcgaag
atcgagccggaggaaggcaagtacgatttcgactggctggaccgtgccatcgataagctc
ggcaaggcgggcatcgccgtagacctcgcctccgccaccgcctccccgccgatgtggctg
acccaggcccatccggaggtgctgtggaaggacgagcgcggcgacaccgtgtggccgggt
gcccgtgagcattggcgtccgacgagccctgtgttccgcgagtacgcgctgaacctgtgc
cgtcgtatggccgagcactacaagggcaacccatacgtggtggcctggcacgtgagcaac
gaatacggctgccacaaccgcttcgactactcggacgacgccatgcgcgccttccagaag
tggtgcaagaagcgctacaagaccatcgacgcggtgaacgaggcctggggaacagcgttc
tgggcccagcacatgaacgatttctccgagatcatcccgcctcgctacatcggtgacggc
aacttcatgaacccgggcaagctgctcgactacaagcggttcagctccgacgcgctcaag
gagctctacatcgccgaacgtgacgtgctggagtccatcacgccgggtctgccgctgacc
accaatttcatggtgtccgccggcggctcgatgcttgactatgacgactggggtgcggag
gtcgatttcgtctccaacgaccactacttcacgccgggcgaggcccatttcgacgaggtt
gcgtacgccgcgtcgctgatggacggcatttcacgcaaggaaccgtggttccagatggag
cattccacctccgcggtgaattggcgtccgatcaactaccgtgcggagccgggctcggtc
gtgcgcgactccctcgcgcaggtcgccatgggcgccgacgccatctgctatttccagtgg
cgacagtccaaggccggcgcggagaagtggcactcctcgatggtgccgcatgcgggcgag
gattcgcagatcttccgtgatgtgtgcgagctgggtgccgatctgggacgtctgtccgac
gagggtctgatgggcaccaagacggtcaagtccaaggtcgccgtcgtgttcgactacgag
tcccagtgggccaccgagtacaccgcgaacccgacccagcaggtcgatcattggaccgag
ccgttggattggttccgcgcgcttgccgacaacggcatcaccgccgacgtggttccggtg
cggtccgattgggattcctacgagattgccgtgctgccgtgtgtgtatttgctgtccgaa
gagacgagccgtagggttcgggagttcgtggcgaacggcggcaagttgttcgtgacgtac
tacaccggattgagcgacgagaacgaccacatctggcttggcggctacccgggctcgatt
cgtgacgtcgtcggcgtgcgcgtcgaagagttcgccccgatgggcaacgacatgccgggc
gcattggatcacctcgacctggacaatggcacggtggcgcatgacttcgccgatgtgatc
acgtccacggccgacacgtccacggtactggcctcctataaggcggaacgctggaccggc
atgaacgaggtgccggccatcgtggccaacgggtatggcgacgggcggaccgtatatgtc
ggatgccgtctgggccgtcaggggcttgcgaagagcctgccggcgatgctgggttccatg
gggctgtcggacctcgccggtgatggccgcgtgctgcgtgtcgaacgcgccgacgccgcg
gcggcgagccacttcgagttcgtgttcaaccgcacccatgaaccggtgaccgtcgacgtt
gagggggaggccatcgcggcttcgctcgcgcatgtcgacgacgggcgggccaccatcgat
ccgacgggcgttgtcgtgctcaggcgataa

  All links  
No link information was found.   
DBGET integrated database retrieval system