KEGG   Bifidobacterium bifidum BGN4: BBB_1400Help
Entry
BBB_1400          CDS       T02135                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BBB_1400 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBB_1400 (glkA)
   00052 Galactose metabolism
    BBB_1400 (glkA)
   00500 Starch and sucrose metabolism
    BBB_1400 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    BBB_1400 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BBB_1400 (glkA)
   00524 Butirosin and neomycin biosynthesis
    BBB_1400 (glkA)
Enzymes [BR:bbf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BBB_1400 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1669256..1670206
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDENDAITHRWRVPTPMDADAINHHIANIYHEAVAAGHDDIQA
IGISAAGNVGADRRTLTFAANIPAWINYDLSEHIGALIDHAVPVVVENDANCAGWGEYVH
GAGQGSSNMVALTVGTGLGGAIVIDGRLYRGSFGMAAELGHLPMVPDGDTCGCGLRGCAE
RYTSGSALERFAKSAVRRRPQDAERLMELCGGDVDKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRAMAATAAVLDPDVFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHASIVAAT
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctagccattgatatcggaggaaccaaaatcgccgcagccgtatgcgatgaa
aacgatgccatcacacatcgctggcgcgttcccacaccgatggacgccgacgccatcaac
caccacatcgccaacatctaccatgaggccgtcgccgccggccacgacgacatccaggcc
atcggcatctccgcggccggcaacgtcggcgcggaccgccgcaccctcaccttcgccgcg
aacatccccgcgtggatcaactacgacctgtccgagcacatcggcgcgctcatcgaccat
gccgtgccggtcgtcgtcgagaacgacgccaactgcgccggctggggcgaatacgtgcac
ggtgcgggccagggcagctcgaacatggtcgcgctgaccgtaggtaccggactgggcgga
gcaatcgtcatcgacgggcggctgtaccgcggatcgttcggcatggccgcggagctcgga
cacctgccgatggtgccggacggcgacacctgcggatgcgggcttcgcggctgcgcggaa
cgctacacgtctggaagcgcgctggaacggttcgccaagtccgccgtgcgccgacgcccg
caggacgccgaacgcctgatggagttgtgcggcggcgacgtcgacaagctcgaaggcccg
atggtctcgcaggccgcgcaggagggcgacgtgctcggcctgtacgccttcggcaaaatc
ggcgaatggctcggccgcgcgatggccgccaccgccgcggtgctcgacccggacgtcttc
gtgatcggcggtggcgtagtggcggtcggcgacatcctgctggagccggcgcgatacaac
tatcagcggttcctggagggcagcgcataccgtggccacgcgagcatcgtcgccgccacc
gccgggcaggacgccggcctgatcggcgccgccaacctggcactgcgctaa

DBGET integrated database retrieval system