KEGG   Bifidobacterium bifidum BGN4: BBB_1414Help
Entry
BBB_1414          CDS       T02135                                 

Gene name
hexa
Definition
beta-hexosaminidase A (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bbf00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bbf00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1682575..1685916)
Genome map
AA seq 1113 aa AA seqDB search
MEKSSNRRFGVRTVAAIVAGLMVGGMCTAMTASAADDSAAGYSATAPVNLTRPATVPSMD
GWTDGTGAWTLGEGTRVVSSDALAARAQSLASELTKFTDVDIKAATGSATGKDISLTLDA
SKKAELGDEGFKLSIGSKGLEVIGATDIGVFYGTRSVSQMLRQGQLTLPAGTVATKPKYK
ERGATLCACQINISTDWIDRFLSDMADLRLNYVLLEMKLKPEEDNTKKAATWSYYTRDDV
KKFVEKANNYGIDVIPEINSPGHMNIWLENYPEYQLADNSGRKDPNKLDISNPEAVKFYK
TLIDEYDGVFTTKYWHMGADEYMIGSSFDNYSKLKTFAEKQYGAGATPNDAFTGFINDID
KYVKAKGKQLRIWNDGIVNTKNVSLNKDIVIEYWYGAGRQPQELVQDGYTLMNATQTLYW
SRSAQVYKVNAARLYNNKNWNVGTFDGGRQIDKNYDKLTGAKVSIWPDSSIYQTENEVEK
EIFDGMRFISQMTWSDSRPWATWNDMKADIDKIGYPLDIREYDYTPVDAGIYDIPQLASI
SKGPWELITTPDGYYQMKDTVSGKCLALFTGSKHLDVVTQVGATPELRNCADVSVGQDQR
NTANERNTQKWQIRADKDGKYTISPALTQQRLAIATGNEQNIDLETHRPAAGTVAQFPAD
LVSDNALFTLTGHMGMSATVDSKTVNPASPSKITVKVRAASNANTGDVTVTPVVPEGWEI
KPGSVSLKSIPAGKAAIAYFNVVNTTGTGDATVQFKLTNTKTGEELGTTSVALTGSLTKD
VEASDYAASSQETTGEHAPVGNAFDKNANTFWHSKYSNPSANLPHWLAFKASPGEGNKIA
AITHLYRQDKLNGPAKNVAVYVVAASTANSVADVTNWGEPVATAKFPYTKELQTIPLPNT
IPSGDVYVKFQINDAWGLSETSAGVTWAAVAELAATAKATPVELTEPEQPKDNPEVTETP
EATGVTVSGDGVANGALSLKKGTTAQLTAKVAPDDADQAVTWASSDDKVVTVDKTGKVTA
VAKGVAKVTATTANGKSASVAVTVTEDSEVPGPTGPTEPTKPGTEKPTTKPTTKPNDGKL
SATGADTAVLATIAALFALAGGAVVAVRRRSVR
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaagctccaatagacgtttcggtgtgcgcaccgttgcggccattgtagccggc
ctgatggtcggtggcatgtgcaccgcgatgacggccagcgccgccgacgatagtgcagcc
gggtacagtgccacggctcccgtgaatctcacccgcccggccaccgtcccgagtatggac
ggctggaccgacggcaccggcgcatggacgctgggcgaaggcacccgcgtcgtgtcgagc
gatgcactggccgcgcgtgcgcagagcctggcatccgagctgaccaagttcaccgacgtg
gacatcaaggccgcgaccggttcagcgacgggcaaagacatctcgctcacgttggatgca
tcgaagaaggccgaactgggggatgagggattcaagctgtccatcggctcgaagggcctt
gaggtcatcggcgcgaccgacatcggtgtgttctacggtacccgttccgtctcgcagatg
cttcgccagggccagctgaccctgcccgccggcacggtcgccacgaagccgaagtacaag
gagcgcggcgcgacgctgtgcgcctgccagatcaacatctccactgactggatcgaccgt
ttcctgtcggacatggccgacctgcgcctcaactacgtgctgctggagatgaagctcaag
ccggaagaggacaacaccaagaaggccgccacatggtcgtactacacgcgcgacgacgtc
aagaagttcgtcgagaaggcgaataactacggcatcgacgtgattccggagattaactcc
ccgggccacatgaacatctggctggagaactacccggagtaccagcttgccgacaactcg
ggccggaaggatcccaacaagctcgacatctccaacccggaggccgtgaagttctacaag
acgctgattgacgaatacgacggtgtattcaccacgaaatactggcacatgggcgccgac
gagtacatgatcggtagcagcttcgacaactacagcaagttgaagacgttcgccgaaaag
cagtacggagccggcgcgacaccgaatgatgcgttcaccggcttcatcaacgacatagat
aaatacgtcaaggccaagggcaagcagctgcgcatctggaacgacggcatcgtcaacacc
aagaacgtctccctgaacaaggacatcgtcatcgaatactggtatggcgccggccgccag
ccgcaggagctcgttcaggacggatacacgttgatgaacgcgacccagaccctgtactgg
tcccgttcggcacaagtgtacaaggtcaacgccgcaagactgtacaacaacaagaactgg
aacgtcggaacctttgacggcggacgacagatcgacaagaactacgacaaactgaccggt
gcgaaggtatccatctggcccgacagctcgatctaccagaccgagaacgaggtcgagaag
gagatcttcgacggcatgcgcttcatctcgcagatgacgtggtccgattcccgcccgtgg
gcgacgtggaacgatatgaaggcggacatcgacaagatcggctacccgctggacatccgc
gaatacgactacaccccggtcgatgccggcatctacgacatcccccagctcgcttcgatt
tccaaaggcccgtgggagctcatcaccacgcctgacggctactaccagatgaaggataca
gtgtccggaaagtgtcttgcgctcttcaccggaagcaagcatctcgatgtcgtcacccag
gtcggcgcgacgccggaactgcgcaactgcgccgacgtgtccgtcggtcaggaccagcgc
aacaccgccaatgagcgtaacacgcagaagtggcagatccgcgccgacaaggatggcaag
tacaccatctccccggcgctgacgcagcagcgtctcgccatcgccaccggcaacgagcag
aacatcgatctggagacccatcgtcccgccgctggcaccgtcgctcagttcccggctgac
ctggtcagcgacaacgcgctgttcacgctcaccggccacatgggcatgtccgccaccgtg
gactccaagaccgtgaacccggcctccccgtccaagatcaccgtcaaggtgagggccgca
tccaacgcgaacactggtgacgtcaccgtcaccccggtcgtgccggaaggctgggagatc
aagcccggaagcgtcagcctcaagtcgattccggccggcaaggccgccatcgcctacttc
aacgtggtcaacaccactgggacgggcgacgccaccgtgcagttcaagctcaccaacacc
aagaccggtgaagagctcggcaccaccagcgtggcgctgaccggcagcctgaccaaggac
gtggaagcaagcgactacgcggcgagctctcaggagaccaccggcgagcatgctcccgtg
ggcaacgccttcgacaagaacgcaaacacgttctggcacagcaagtactccaaccccagc
gccaatcttccgcactggctggcgttcaaggcgtcgcccggcgagggcaacaagattgcg
gccatcacccacctgtaccgtcaggacaagctgaacggcccggccaagaacgtcgcagtg
tacgtggtggcggccagcaccgccaacagcgtcgccgatgtcaccaactggggtgaaccc
gtcgccacggctaagttcccgtacaccaaggaactgcagaccatcccgctgccgaatacc
attccgtccggtgacgtgtacgtcaagttccagatcaacgacgcatggggcctctccgaa
accagcgcaggcgtcacctgggcggctgtcgccgagctggctgcgacggccaaggccact
ccggtcgagctcaccgagcccgagcagccgaaggacaaccccgaggtgacggagactccg
gaggctacgggtgtgaccgtttctggcgatggtgttgccaatggcgcgctgtcgctgaag
aagggcaccaccgcgcagctgaccgcgaaggtcgcgccggatgacgcggaccaggcggtg
acgtgggcctccagcgatgacaaggtcgtgacggtcgacaagaccggcaaggtgaccgcc
gtcgcgaagggcgtggcgaaggtgaccgcgaccacggcgaacggcaagtccgcctctgtg
gccgtcaccgtcaccgaggactctgaggtgcccggcccgactggcccgaccgagcctacc
aaaccgggtacggagaagccgaccacgaagccgaccacgaagccgaacgacggcaagctc
agcgccaccggcgccgacacggcggtgctcgccaccatcgcggctctgttcgcgctggcc
ggcggtgcggtcgtcgcggttcgtcgccgcagcgtccgctga

DBGET integrated database retrieval system