KEGG   Bifidobacterium bifidum BGN4: BBB_1418Help
Entry
BBB_1418          CDS       T02135                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1688265..1689779)
Genome map
AA seq 504 aa AA seqDB search
MDTIRLTGVQGMGTHGVLDYEHQRAQPFIVDAVLHLDLSRAGSSDDLHDTVDYGRVAKRI
VSVIEGEHVDLIERLAALIADAVIADHPAVQGVTVTVHKPKAPITVPFADVSVTIERWRS
GRNTDGKTGRADEGRVTPMHHAVIALGGNKGDVAASMRSAIADIDGLEGTQVTGISPLYR
TAAWGMPDGTPDFLNAVIEVTTELDAASLLGRLQHIEVAHGRTREQHWASRTLDLDIIDV
DGLVSEDPNVTLPHPRAWQRAFVLAPWLALDPAARLAGPHGGEIADLLHEAGDRKDVHRI
DDSWMTGMADDVRVQPSGSAADIPQFDGTVDGSARKPGDGDTATVQPAIHTAVISMDSRS
NEAETLFRTAIVALEGIPGDQVEGISPLYHVSHLHGSDAMSAVMQMTCRMDAKALIATLG
SVEESLNGDVDLDLVDMPGTVCDEPDCRVPWPSARTHASVLAPWMDMDPQARLGGDPVSY
LLAMAPDADRVGLLSDTWIVGSTE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtggacacgattcgcctcaccggcgttcaaggcatgggcacgcacggcgtgctggactac
gagcaccagcgcgcgcagcccttcatcgtcgatgccgtgctgcatctcgacctgtcacgt
gccggttccagcgatgacctgcatgacacggttgattacgggcgcgtcgccaaacggatc
gtatccgtcatcgaaggcgagcatgtcgacttgattgagcggctggcggctctcatcgct
gacgccgtgatagccgaccatcccgcagtccaaggcgtaaccgtcaccgtgcataagccc
aaagctccgatcaccgtgccgttcgccgacgtgagcgtcaccatcgagcgatggcggagc
ggacggaatacggacggaaaaactggtcgagctgatgaaggccgtgtcacgcccatgcac
cacgccgtgatcgcactcggcggcaacaagggcgacgtcgcggcgtcgatgcggtccgcg
atcgcggatatcgacggccttgaaggcacacaggtgactgggatatcgccgttgtaccgc
accgccgcatggggcatgccggatggtaccccggattttctcaacgctgtcatcgaggtc
acgaccgagctggacgcggcgagtctgcttggccgcctgcagcatattgaagttgctcat
ggacgcacgcgggaacaacattgggcgtcgcgcacactggatcttgacatcatcgatgtc
gatggcctcgtcagcgaggacccgaatgtgactttgccgcatccgcgtgcgtggcagcgg
gcgttcgttttggcaccgtggctggctcttgatccggccgcccggctcgcgggcccgcac
gggggagagattgccgatttgctgcacgaggccggtgaccgcaaggacgtacatcgcatc
gacgacagttggatgaccggcatggccgacgatgtccgggtgcagccgtccggcagcgca
gccgacataccgcaattcgatggaaccgtcgacggttcggcgcggaaaccgggcgacggc
gataccgctaccgttcaaccggccatacatacggccgtcatctcgatggacagccgcagt
aacgaggccgaaaccctgttccgcacggcgattgtcgcattggagggcattcccggtgat
caggtcgagggcatctcaccgctgtatcatgtgagccatctgcatgggtcggatgccatg
tcggctgtcatgcaaatgacgtgccggatggacgcgaaggcgctgattgccacgctcggt
tccgtcgaggagtcgttgaacggggatgtcgacctcgatctggtggatatgccgggaacg
gtctgcgatgagccggactgccgggtgccgtggccgtcagcccgcacccatgcttcggtg
ctcgcaccgtggatggacatggacccgcaggcgcggctcggcggcgacccggtgtcgtat
ctgctggccatggcacccgacgccgaccgtgtgggactgctgtccgacacttggatcgta
gggagtacggaatga

DBGET integrated database retrieval system