KEGG   Bifidobacterium bifidum BGN4: BBB_1420Help
Entry
BBB_1420          CDS       T02135                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
bbf00790  Folate biosynthesis
bbf01100  Metabolic pathways
Module
bbf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BBB_1420 (folE)
Enzymes [BR:bbf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BBB_1420 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF RNase_Zc3h12a_2
Motif
Other DBs
NCBI-ProteinID: AFL05011
UniProt: I3WJE8
Position
complement(1690800..1691366)
Genome map
AA seq 188 aa AA seqDB search
MAIDEEGVRKAVRLFLTSIGENPDREGLLETPDRIARACEEIFSGLGRSPQEVLSKRFPV
ETDEMVLVRDIELFSVCEHHLLPFHGVAHVGYIPSNGQVVGLSKLARLVELYARRPQVQE
RITQQVADALMEYADAKGVIVVTECEHMCMAMRGVNKPASRTITSAVRGVMRTPATRAEA
MSLIMAKH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcgattgacgaagagggcgtgcgcaaggccgtacggctgttcctgacttcgatcggc
gagaatcccgatcgcgagggtctgctggagacgcctgaccgtatcgcacgtgcctgcgag
gagattttctcagggctcggacgcagcccgcaggaggtgctgtccaagcgtttcccggtc
gagaccgatgaaatggtgctggtgcgcgacatcgagctgttctcggtgtgcgagcatcat
ctgctgccgttccacggcgtcgcgcatgtcggctacatcccgtccaacgggcaggtcgtc
ggattgagcaagctcgcccgactggtggagctgtacgcgcgtcgcccgcaggtgcaggaa
cgcatcacccagcaggtcgcggacgcgctgatggaatacgcggacgccaagggcgtcatc
gtcgtgaccgaatgcgagcacatgtgcatggcgatgcgaggcgtgaacaagcccgcgtcg
cgaaccatcacatcggcggtccgcggcgtgatgcgcaccccggccacccgtgccgaggcg
atgagtctgatcatggccaagcactga

DBGET integrated database retrieval system