KEGG   Bifidobacterium bifidum BGN4: BBB_1549Help
Entry
BBB_1549          CDS       T02135                                 

Gene name
malQ
Definition
4-alpha-glucano transferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBB_1549 (malQ)
Enzymes [BR:bbf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BBB_1549 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1843015..1845240)
Genome map
AA seq 741 aa AA seqDB search
MTESTESAERLARPLIHLAHLVGLATSYIGMSDDYHEIDDDVLKALLGALGVDAHDDDAI
DDSVVRILRERHGRLVAPTVLHVVGKEDRVLLNTGIMQIPSATITLENGDEYQGALEPGA
GDGSQAYEVDGKFVATASITIPADLPMGYHTLHVSVGDRTQDATLISAPERIPMLPAMEH
DQLWGWMAQLYSIRSAGSWGVGDFEDLKTLMVDSHSKTGADFMLVNPLHACEPVAPLTPS
PYLPISRRFINFTYIRPEAIEEYAGLGDDLKSQIGELHAQAEPLNGDAQIIDRDSMWRVK
MHALWLIFKAGRSEERQKAFDDYKSTSAEGLEAYATWCLCYDKWGAPTGEADSWEKRLDK
NSDEVQGLRRQFPDTLDFYRWLEWIADEQLGAAQQAAKDAGMQIGLMADMAVGVHPSGSD
VWWNPECFAKGATVGAPPDYFNQQGQDWSQPPLNPIELENTGYLTYRHMVQGMFAHAGAV
RIDHILGLFRLWWIPSGHTPKDGAYVQYDSEIMLGILALEASRAHGVVVGEDLGVVPDHV
STSLSAHQVLGCAVEWFEQMDGKFRAPKDWREFSLASVNTHDLPPAAGYLAYEHVELRER
LGLIEGSVEDFEQNARAEHKAMMVMLIVNGYLRPRPAEGRESPRAGDRRGAVPRPARLPV
QAARGVHRGRRGRAPRPEPARHQQRISELAHPAGRRQGQCRAAGGAVLQHASALARQGHA
GALRVRYGHAIRPYMRCRSAG
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgacagagagtacagaaagtgcggagcgtctcgcgcgtccgctgatccatctggcgcat
ctggttggattggccacgagctacatcggcatgagcgacgactatcacgagatcgatgat
gatgtcctgaaggcgttgctgggtgcgttgggcgtggacgcccatgacgatgacgccatc
gatgattccgttgtccgtatccttcgcgagcgccacgggcgtctcgtcgccccgaccgtg
ttgcatgtcgtcggcaaggaagatcgtgtgctgctcaacaccggtatcatgcagattccc
tccgcaaccatcacgctggaaaacggcgacgaataccagggtgcgctggagccgggagcc
ggagacggatcgcaggcgtacgaggtcgacggcaagttcgtggcgacggcatccatcacc
atacccgcggatctgccgatgggataccatacgctgcatgtcagcgtgggcgaccgcacg
caggacgccacgctgatcagcgcccccgagcgtattccgatgctgccggccatggaacat
gaccagctgtggggctggatggcccagctgtattccatccggtccgccggatcctggggc
gtgggcgatttcgaggacctcaagaccctcatggtcgattcgcacagcaagaccggcgcc
gatttcatgctggtcaacccgctgcacgcgtgcgagccggtagcgccgctcaccccgtcg
ccgtacctgccgatttcccgccgcttcatcaacttcacgtacattcgtcccgaggcgatc
gaggaatatgccggcctcggcgatgacctgaaatcgcagatcggcgagctgcacgcgcag
gccgaaccgctgaacggggacgcgcagattatcgaccgtgattcgatgtggcgcgtgaag
atgcacgccctgtggctgatttttaaggccgggcgcagcgaggagcgtcagaaggcgttc
gacgactacaagagcacgtccgccgaagggcttgaggcctacgccacgtggtgcctgtgc
tacgacaagtggggcgcgccgaccggcgaagccgacagctgggagaagcgcctcgacaag
aacagcgacgaggtgcaggggctgcgtcgacagttccccgacacattggacttctatcgc
tggttggaatggatcgccgacgagcagctgggagccgctcagcaggccgcgaaggacgcc
ggcatgcagatcggcctcatggccgacatggcggtcggcgtgcatccgtccggctccgac
gtgtggtggaacccggagtgtttcgccaagggcgccacggtcggcgcgccgccggattac
ttcaaccagcaggggcaggactggagccagccgccactcaacccgatcgagctggagaac
accggctacctcacgtatcgtcacatggtgcagggcatgttcgcccatgcaggcgcggtg
cgcatcgaccacatcctcggcctgttccgcctgtggtggatcccctccgggcacacgccc
aaggacggcgcctatgtgcagtacgattccgagatcatgctcggcatcctggcacttgag
gcgtcgcgcgcccacggcgtggtcgtcggcgaggatctgggcgtcgtgcctgaccacgtc
tcgacgtcgctgtccgcgcatcaggtgctgggttgcgccgtcgaatggttcgagcagatg
gacggcaagttccgcgccccgaaggattggcgcgagttctcgctcgcctcggtgaacacg
cacgacctgccgcccgcagccggatatctcgcatacgagcacgtcgaactgcgcgagcgc
ctgggactgatcgaaggatcggtcgaggacttcgagcagaacgcgcgcgccgagcacaag
gccatgatggtcatgctgatcgtcaacggctatctccgaccccgacctgctgaaggacga
gaaagcccacgagcaggagatcgtcgaggcgctgtaccgcggcctgcgcggctccccgtg
caagctgctcgcggcgtccatcgtggacggcgtgggagagcgccgcgcccagaaccagcc
cggcaccaacaacgaatatccgaactggcgcatcccgctggccgacggcaagggcaatgt
cgtgccgctggaggagctgttctccaacacgcgtctgctctcgctcgccaaggtcatgca
ggggcgctgagggtgcgatatgggcatgccatccggccgtacatgaggtgtcgttcggcc
ggatga

DBGET integrated database retrieval system