KEGG   Bifidobacterium bifidum BGN4: BBB_1751Help
Entry
BBB_1751          CDS       T02135                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BBB_1751 (recR)
DNA repair and recombination proteins [BR:bbf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BBB_1751 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2087833..2088435)
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDAFAGLPGIGPKGAQRIAFYLLSASDEETGKLVDAITEVKEKVRFCD
ICGNVCEVSPCPVCADPRRDHGVICVVEEPKDVMSIERTREYRGQYHVLGGAINPMANVG
PADLNIPKLLDRLKTDEVKEVILALDPNIEGEATTTYLSRLLSPLGIKVTRLASGLPVGS
DLEYADEVTLGRALTGRREA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttggcatatgacggcgcgatacagcgactcatcgacgcatttgccggactgccc
ggcatcggcccgaaaggggcgcagcgcatcgccttctatctgctgtcggcctccgacgag
gagacgggcaagctggtcgacgccatcacggaagtcaaggaaaaagtgcggttctgcgac
atctgcggaaacgtgtgcgaggtcagtccgtgcccggtatgcgccgacccgagacgcgac
cacggggtgatctgcgtggtcgaagagccgaaggacgtgatgagcatcgagcgcacccgt
gaataccgcggccaataccatgtgctcggcggcgccatcaacccgatggccaacgtcgga
ccggccgacctcaacatccccaagcttctcgaccgcctcaagactgacgaggtcaaggaa
gtcatcctcgcactcgaccccaacatcgaaggcgaggcgacgacgacatacctgagtcgt
ctgctcagcccgctcggcatcaaggtcacccggctcgccagcggtctgcccgtcggcagc
gacctcgaatacgccgacgaggtcacgcttgggcgggccctcacaggtcgccgcgaagca
taa

DBGET integrated database retrieval system