KEGG   Bifidobacterium bifidum BGN4: BBB_1797Help
Entry
BBB_1797          CDS       T02135                                 

Gene name
phoA
Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bbf  Bifidobacterium bifidum BGN4
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbf00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bbf00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bbf02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2147531..2149663)
Genome map
AA seq 710 aa AA seqDB search
MNINKMLKGAVAALTSAAALGALTAPAFAASGTYDLNGKGVDALSVHGGAQRIATIGNAK
AKNVILFIGDGMGDSEITVARNYLHGVNGTFQGLDKIGQPGALQTSTGKAAESGVGQYTT
FSLGGSSNDSLMAKDSKGQLTGSKTAGVITPVTDSSASGSGWATGTKTYNNAVSVDVKGN
PQLNLIELAKANGLATGNVTTSEIQDATPAVQESHSSERACYGPQGKWDGTDKNGDGKVD
IKDAELAGIGRCLADQLKANGGIGSISEQLLDTRADVTIGGGAKYFNQLDENGNTLWQQA
ADRGFQTVKSGDVDGFKNLTYKDGQPVLALLGDGNLPTQFNPSVATKQDAAKDANPTVCT
TNAKWLGNQGASLADFTDKALDLLQANPKSEKGFFLQVEGASIDKQDHNANACGQIGETD
DLDKAISAALKKVDLSDTLIIVTADHAHTSQIVESQPYYALSTVLKNADGSKTTISYGTS
EKNLYSDGQDTEGAADSSKAQGNMSHTGTQLRIAASGPGASRVDGLTDQTDNFYTIAGAL
GLATDTTSQNNLSNGGKVTVNKDKDGKYSAAVTGFNGDAVLSYQLVDNASKKVVAESNTS
TPLSGVRVATAATTSISFADFTPAEGASYTLTVNGRQSGKSASVSFPSASGSADKTPNGG
NGSGTVAQGTVKEPTAPLGKTGATVLGLALMVLALGAGAMVVRSVKAGRR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaacaaaatgctcaaaggcgccgtcgcggcgttgacctcagctgcggccctg
ggcgcgctgaccgctccggcgttcgccgcgagcggcacctacgatctgaacggcaagggc
gtggacgccctgtcggtgcacggcggcgcccagcgcatcgccacaatcggcaacgcgaag
gcgaagaacgtcatcctgttcatcggcgacggcatgggagattccgagatcaccgtcgca
cgcaactacctgcacggcgtcaacggcacgttccagggcctcgacaagatcggccagccg
ggcgcactccagacctcgaccggcaaggccgccgaaagcggcgtcggccagtacaccacg
ttctcgctgggcggcagctccaacgattcgctgatggccaaggattccaagggccagctc
accggttccaagaccgccggcgtgatcaccccggtcaccgactcctccgcctccggctcc
ggctgggcgaccggcaccaagacctacaacaacgccgtgtccgtggacgtcaagggcaac
ccgcagctcaacctcattgagctcgccaaggccaacggcctcgccaccggcaacgtgacc
acctccgagatccaggatgccactccggcggtccaggaatcccactcctccgagcgcgcc
tgctacggcccgcagggcaagtgggacggcaccgacaagaacggcgacggcaaggtcgat
atcaaagacgccgagctcgccggcatcggcaggtgcctcgccgaccagctcaaggccaac
ggtggcatcggctccatctccgagcagctgctcgacacgcgcgccgacgtgaccatcggc
ggcggcgccaagtacttcaaccagctcgacgagaacggcaacaccctgtggcagcaggcc
gctgaccgcggtttccagaccgtcaagagcggtgacgtcgacggcttcaagaacctgacc
tacaaggatggccagccggtgctcgccctgctcggcgacggcaacctgccgacccagttc
aacccgtctgtggccaccaagcaggacgccgccaaggacgcgaacccgaccgtgtgcacc
accaacgccaagtggctcggcaatcagggcgcgtccctcgccgacttcaccgacaaggcg
ctcgacctgctgcaggccaacccgaagtccgagaagggcttcttcctgcaggtcgaaggc
gcttccatcgacaagcaggaccacaacgccaacgcctgcggccagatcggcgagaccgac
gaccttgacaaggccatctccgccgctctcaagaaggtcgacctgagcgacaccctcatc
atcgtgaccgccgaccacgcccacacctcgcagatcgtcgaatcccagccgtactacgcg
ctgagcaccgtgctgaagaacgccgacggctccaagaccaccatctcctacggcacctct
gagaagaacctgtactccgacggccaagacaccgaaggcgcggccgattccagcaaggcc
cagggcaacatgagccacaccggcacccagctgcgcatcgccgcatcgggtcccggtgcg
tcccgcgtggatggcctgaccgaccagaccgataacttctacacgatcgccggcgccctt
ggcctggcgaccgacaccacgtcgcagaacaacctgtccaacggcggcaaggtcaccgtg
aacaaggacaaggacggcaagtacagcgcggccgtcaccggcttcaacggtgacgcggtg
ctgtcgtaccagctggtcgacaacgcctccaagaaggtcgtcgccgagtccaacacgtcc
accccgctctccggcgtgcgcgtcgccaccgcggccaccacctcgatctcgttcgccgac
ttcactccggccgagggcgcgtcctacacgctgacggtgaacggccgccagtccggcaag
tccgcctccgtgagcttcccgtccgcctcaggctccgccgacaagacgccgaacggcggc
aacggcagcggcactgtcgctcagggcaccgtcaaggagccgaccgctcctctgggcaag
accggcgcgaccgtgctcggcctggcgctgatggtgctcgctctgggcgccggcgcgatg
gtcgtgcgctccgtcaaggcgggtcgccgctga

DBGET integrated database retrieval system