KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_005Help
Entry
BGIGA_005         CDS       T02109                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00020  Citrate cycle (TCA cycle)
bbg00310  Lysine degradation
bbg01100  Metabolic pathways
bbg01110  Biosynthesis of secondary metabolites
bbg01120  Microbial metabolism in diverse environments
bbg01130  Biosynthesis of antibiotics
bbg01200  Carbon metabolism
Module
bbg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BGIGA_005 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BGIGA_005 (sucB)
Enzymes [BR:bbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BGIGA_005 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AFJ90465
UniProt: I3QFT0
Position
complement(6121..7311)
Genome map
AA seq 396 aa AA seqDB search
MAEYNLPLPAMGESIAEATVIRWLKEEGDSIKKEDVLVEIATDKVDSEISSPVNGILKKK
LFAPNEVAKVGSFIAILEIEEKFPLEDISIEKNKKRFYSPLVRTIAHREGISFYELETIK
GTGEKERVTKKDILKYIRIKKNSIVIPKCDRNIKSSINNDENEEIIEMDRIRRITAEHMI
NSKNISAHVTSFVEADVTNIVKWRDKIKDNFQKNTGEKLTLMSVFVECVVKAIKDLPMIN
ISVNGTNIIKKRNIHIGLATALPNGNLVVPVIKNADSYNLVGLIKIINDLIKRAKSNQLK
PEETQGGTYTISNIGSFGNLFGTPIIHQPQVAIMAIGLIQKKLSIIETPEGDLIGIRHKI
YLSHSYDHRVIDGVLGGFFAKKVALYLEKFNCYTKI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtataatttgccccttccagccatgggtgaaagtatagctgaggctactgtc
attcgttggttaaaagaagagggagattctataaaaaaagaagatgttttagttgaaata
gctacagataaagtagattctgaaatatcttcccctgtaaatgggatattaaaaaagaaa
ctattcgctcccaatgaagttgctaaagtgggaagtttcattgctattttagaaatagaa
gaaaaatttcctttagaggatatatcaatagaaaaaaataaaaaacgtttttattctcct
cttgtacgaacaattgctcatagagaaggaattagtttttatgaattggaaacgataaaa
ggaactggagaaaaagaacgtgttactaagaaagatatattaaaatatattcgtattaaa
aaaaatagtattgttattcctaaatgcgatagaaatattaaaagtagtataaataatgat
gaaaatgaagaaatcattgaaatggatagaatacgtaggattactgcggaacacatgatt
aatagtaaaaatatttctgcacatgtaacttcttttgttgaagcggatgttactaacata
gtaaaatggagagataaaataaaagataattttcagaaaaatacgggagaaaaattaact
ttaatgtccgtctttgtagaatgtgttgtaaaagctataaaagatcttcccatgataaat
atttccgtaaatggaacaaacataataaaaaaaagaaatattcatataggattagctaca
gcattacctaatggtaatttggttgttcctgtaataaaaaatgcagattcttataattta
gtaggattaataaaaattataaatgacttaataaaaagagctaaatctaatcaattaaaa
cctgaagaaactcaaggtggaacttatactataagtaatataggaagttttggaaatctt
tttggtacacctattatacatcaaccacaggttgctattatggcgataggattaattcaa
aaaaaattgtctataatagaaactccagaaggagatttaataggcataagacataaaatt
tatttatctcattcttatgatcaccgtgtaatagatggtgttttaggtggatttttcgct
aaaaaagtagctttatatttagaaaaatttaattgttatacaaaaatataa

DBGET integrated database retrieval system