KEGG   Blattabacterium BGIGA (Blaberus giganteus): BGIGA_005Help
Entry
BGIGA_005         CDS       T02109                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbg  Blattabacterium BGIGA (Blaberus giganteus)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BGIGA_005 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BGIGA_005 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BGIGA_005 (sucB)
Enzymes [BR:bbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BGIGA_005 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6121..7311)
Genome map
AA seq 396 aa AA seqDB search
MAEYNLPLPAMGESIAEATVIRWLKEEGDSIKKEDVLVEIATDKVDSEISSPVNGILKKK
LFAPNEVAKVGSFIAILEIEEKFPLEDISIEKNKKRFYSPLVRTIAHREGISFYELETIK
GTGEKERVTKKDILKYIRIKKNSIVIPKCDRNIKSSINNDENEEIIEMDRIRRITAEHMI
NSKNISAHVTSFVEADVTNIVKWRDKIKDNFQKNTGEKLTLMSVFVECVVKAIKDLPMIN
ISVNGTNIIKKRNIHIGLATALPNGNLVVPVIKNADSYNLVGLIKIINDLIKRAKSNQLK
PEETQGGTYTISNIGSFGNLFGTPIIHQPQVAIMAIGLIQKKLSIIETPEGDLIGIRHKI
YLSHSYDHRVIDGVLGGFFAKKVALYLEKFNCYTKI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtataatttgccccttccagccatgggtgaaagtatagctgaggctactgtc
attcgttggttaaaagaagagggagattctataaaaaaagaagatgttttagttgaaata
gctacagataaagtagattctgaaatatcttcccctgtaaatgggatattaaaaaagaaa
ctattcgctcccaatgaagttgctaaagtgggaagtttcattgctattttagaaatagaa
gaaaaatttcctttagaggatatatcaatagaaaaaaataaaaaacgtttttattctcct
cttgtacgaacaattgctcatagagaaggaattagtttttatgaattggaaacgataaaa
ggaactggagaaaaagaacgtgttactaagaaagatatattaaaatatattcgtattaaa
aaaaatagtattgttattcctaaatgcgatagaaatattaaaagtagtataaataatgat
gaaaatgaagaaatcattgaaatggatagaatacgtaggattactgcggaacacatgatt
aatagtaaaaatatttctgcacatgtaacttcttttgttgaagcggatgttactaacata
gtaaaatggagagataaaataaaagataattttcagaaaaatacgggagaaaaattaact
ttaatgtccgtctttgtagaatgtgttgtaaaagctataaaagatcttcccatgataaat
atttccgtaaatggaacaaacataataaaaaaaagaaatattcatataggattagctaca
gcattacctaatggtaatttggttgttcctgtaataaaaaatgcagattcttataattta
gtaggattaataaaaattataaatgacttaataaaaagagctaaatctaatcaattaaaa
cctgaagaaactcaaggtggaacttatactataagtaatataggaagttttggaaatctt
tttggtacacctattatacatcaaccacaggttgctattatggcgataggattaattcaa
aaaaaattgtctataatagaaactccagaaggagatttaataggcataagacataaaatt
tatttatctcattcttatgatcaccgtgtaatagatggtgttttaggtggatttttcgct
aaaaaagtagctttatatttagaaaaatttaattgttatacaaaaatataa

DBGET integrated database retrieval system