KEGG   Blattabacterium BGIGA (Blaberus giganteus): BGIGA_050Help
Entry
BGIGA_050         CDS       T02109                                 

Gene name
sucC
Definition
succinyl-CoA ligase (ADP-forming) subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bbg  Blattabacterium BGIGA (Blaberus giganteus)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BGIGA_050 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BGIGA_050 (sucC)
   00640 Propanoate metabolism
    BGIGA_050 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BGIGA_050 (sucC)
Enzymes [BR:bbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BGIGA_050 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
60810..62015
Genome map
AA seq 401 aa AA seqDB search
MNLYEYQGREILKSFSIQVPDGMLAYSPEDAVRVAKILFKKTKKKSLVIKAQIHAGGRGK
AGGIQIAKNLDEVYEKSKNILGKFLITPQTSKKGKLVKKILLSEDVYFSELSPPTEYYLS
ILLNRDIEKNMILYSREGGVNIEDISKKNPNQVYTEVIDPILGLQFFQTRKIGFNLGIYS
NDFLKNFSFFLFSLYKSYINYDALLLEINPLIKTFDEKIVPVDVKIILDDNALFRHKKYN
LIRDKDNDINTIEKEAIEAKLNFLKLKGNVGCMVNGAGLAMATMDMIKSCGGVPANFLDI
GGSADQKRVETAFDLILKDKSVKTIFINIFGGIVRCDTVAEGIINSYSKINQNIEIPVVV
RLQGTNEKIAKKLIKKSLLPIYSTDSLKEASYKIQEILHIK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatatgaataccaaggtagagaaatattgaaatctttctcaattcaagttcct
gacggaatgttggcttattctcctgaagatgctgtaagagtggctaaaattctttttaaa
aaaactaaaaaaaaatctttggttattaaagctcaaattcatgctggaggaagagggaaa
gcaggtggtattcaaatcgcaaaaaatttggatgaagtttatgaaaaatctaaaaacatt
ttaggaaaatttttaatcacccctcaaacttctaaaaaaggaaaattagttaaaaaaatt
ttattgtctgaagatgtttatttttccgaattaagtcctcccacagagtattatttatcc
atattattgaatcgtgatatagaaaaaaatatgattctttattctcgagaaggaggggtt
aatatagaagatatttcaaaaaaaaatccaaatcaagtatatacagaagtaatagatcct
atattaggacttcaattctttcaaacaagaaaaattggtttcaatttaggaatatatagc
aatgattttttaaagaattttagcttttttttattctcactttataagtcctatataaat
tacgatgctttgttattagaaatcaatcctttgataaaaacatttgatgaaaaaatcgta
ccagttgatgtaaaaattattttggatgataatgctttgtttcgtcataagaaatacaat
ttaatacgtgacaaagataatgatattaatacgattgaaaaagaagctattgaagctaaa
ttaaattttttaaaattaaaaggaaatgtaggatgtatggtgaatggagctggtttagct
atggctaccatggatatgattaaatcttgtggaggagttcctgctaattttttagatata
ggaggatctgctgatcaaaaacgtgtagaaactgcttttgatcttattttaaaagataaa
tctgtgaaaacaatattcatcaatatatttggaggaattgtacgttgtgatacggttgca
gaaggaattataaattcttattctaaaataaatcagaacattgaaattcctgtagttgtt
cgtttacaaggaacaaacgaaaaaatagcaaaaaaattgatcaaaaaaagtttattacct
atttattctactgattctttaaaagaagcttcctataaaattcaagaaattttacatata
aaataa

DBGET integrated database retrieval system