KEGG   Blattabacterium BGIGA (Blaberus giganteus): BGIGA_069Help
Entry
BGIGA_069         CDS       T02109                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bbg  Blattabacterium BGIGA (Blaberus giganteus)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BGIGA_069 (folE)
Enzymes [BR:bbg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BGIGA_069 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83190..83864
Genome map
AA seq 224 aa AA seqDB search
MIEEKKILKKEKSNSILNRSISPDPILHKDVYFMSDEEKIEKIKKHFFQIMKILGLNMND
DSLQRTPKRVAKMFIKEIFSGLNPKNLPNFSIFENKYKYKQMLIEKNITVYSTCEHHFLP
IVGKAHVGYISNGKVVGLSKINRIVNFYAKRPQVQERLTIQIVQYLRKMLETQDVACVIE
AKHLCVNSRGIRDIDSSTITTELIGSFKNNSEIREEFLHHIGIS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagagaaaaaaattttaaaaaaagaaaaatctaattcgattttaaatcgatca
atcagtccggatcctattttacataaggatgtttattttatgagtgatgaagagaaaatt
gaaaaaataaaaaaacatttttttcaaattatgaaaattttaggtttaaatatgaatgat
gatagtttacaaagaacacctaaacgagtagcaaagatgtttataaaagaaatattcagt
ggactaaatcctaaaaatttgccgaatttttccatttttgaaaataaatataaatacaaa
caaatgttaatagaaaaaaatatcacagtttattctacttgtgaacatcattttcttcct
attgtaggaaaagctcatgtaggttatatttcaaatggaaaagttgtaggtctttctaaa
attaatagaattgtaaatttttacgcaaaaagaccacaagtacaagaacgtttaacaata
caaattgttcagtatttacgaaaaatgttagagacacaagatgtagcttgtgttatagag
gcaaaacatttatgcgtgaattctcgtggaatcagagatatagatagtagtaccattact
actgagttaataggatcctttaaaaataattcagaaataagagaggaatttttacatcat
attggaatttcttaa

DBGET integrated database retrieval system