KEGG   Blattabacterium BGIGA (Blaberus giganteus): BGIGA_137Help
Entry
BGIGA_137         CDS       T02109                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbg  Blattabacterium BGIGA (Blaberus giganteus)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BGIGA_137 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BGIGA_137 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BGIGA_137 (thrC)
Enzymes [BR:bbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BGIGA_137 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
148532..149854
Genome map
AA seq 440 aa AA seqDB search
MLYYSLKNYKNLVSFEDAVLTGLSPDGGLYMPKWIPKLEPKFIRKLPIYDIYTIAMFVIK
PYIGKYIPEKFINNIIHDTLNFSFPLKKIHDNIYVLELFHGPTLAFKDVGAKFMAGCLSF
FSEKLEKNVTVLVATSGDTGGAVAKGFHKKPGIEVIILYPYNGISSLQEKQITSLGDNIL
ALEIHGNFDDCQNMVKKAFLDKEVNKKYSLTSANSINVGRWLPQMFYYFLAYRQIIIKNP
IELIFSVPSGNFGNLCAGMIAEKMGLPIKFFIASTNINDTIPRFLKSEKYHPFPVQKTIS
NAMDISDPSNFSRIWHLYQKNIFQLRKKLSSYKFTDEETLSVIEMIWKKYKYMLDPHGAI
GYLGLRQYLQEVNITSLEPGIFLETAHPIKFFDHMPLFLQKEIIPTQEVEIFLNTKKSKN
KKISLSNDFNVFKNWLLERK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgttgtattatagtttgaaaaattataaaaacttagtttcttttgaagatgctgtttta
acaggtttatcacctgatggaggattatatatgcctaaatggattcctaaattagaacct
aaatttattcggaaacttccaatttatgatatttatacaattgccatgttcgtaataaag
ccttatattggaaaatatattcctgaaaaatttattaataatattattcatgatactttg
aatttttcttttccattaaaaaaaatacatgataatatttatgtattagagctttttcat
ggacctactttagcttttaaagatgtaggagcaaaatttatggcaggatgcttaagtttt
ttttctgaaaaattagaaaaaaatgtaacggttttagttgcaacttcaggagataccgga
ggtgcagttgctaaaggatttcataaaaaacctggaatagaagttattattttgtatcca
tataatggaattagttctttacaagaaaaacaaatcacttctttaggagataatatatta
gcattggaaatccatggaaattttgacgattgtcaaaatatggttaaaaaagctttttta
gacaaagaagtaaataaaaaatattcattaacttctgccaattctataaatgtaggaaga
tggcttcctcaaatgttttattattttttagcttatagacaaatcataataaaaaatccg
atagaattaattttttcagttcctagtggtaattttggaaatctttgtgcgggaatgata
gctgaaaaaatgggtttacctataaaattttttattgcatctacaaatattaatgatact
attcctagatttttaaaatctgaaaaatatcatccttttcccgtacaaaaaactatatca
aatgctatggatatatctgatcccagtaatttttctagaatatggcatttatatcaaaaa
aatatatttcaattaagaaaaaaactatcttcctataaattcacggatgaagaaacttta
tcagttatagaaatgatatggaaaaaatataaatacatgttagatccacatggggctatt
ggttatttaggccttagacaatatttacaagaagtgaatatcacttctttagaaccaggt
atttttttagaaacagctcatcccattaaattttttgatcatatgccacttttcttacaa
aaagaaatcattcctactcaagaagtagaaatatttttgaatacaaaaaaaagtaaaaac
aaaaaaatatcattatccaatgattttaatgttttcaaaaattggttattagaaagaaaa
taa

DBGET integrated database retrieval system