KEGG   Blattabacterium BGIGA (Blaberus giganteus): BGIGA_177Help
Entry
BGIGA_177         CDS       T02109                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bbg  Blattabacterium BGIGA (Blaberus giganteus)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BGIGA_177 (glpK)
Enzymes [BR:bbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BGIGA_177 (glpK)
Exosome [BR:bbg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BGIGA_177 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(192540..194042)
Genome map
AA seq 500 aa AA seqDB search
MFMKKYVLSLDQGTTSSRAIIFDKIGNIISIAQREFTQIYPHPGWVEHNAEEIWSTQASV
ALEAVLKGNLEGENIISIGITNQRETTVVWDRKTGEPIFNAIVWQDRRTIKYCDQIKKEG
LTEMIRKKTGLIIDPYFSATKIKWILENVPGAKKKAYSGSLAFGTIDSWLIWNLTGKEIH
VTDVTNASRTMLFNIHTLSWDQELIDLFNIPVNMLPEVKSSSEIFGYTTGHILSHKIPIS
GIAGDQQAALFGQMCTKIGMVKNTYGTGCFMLMNVGDHPVFSQNNLITTVAWKIKNQVQY
ALEGSVFIAGAVVQWLRDGLGLLLSSNEAEILASSVDNTEGLYMVPAFSGLGAPYWDQKA
RGTIVGITRGTSSAHFVRAALESIAFQNMDVLKAMEADSGILIKELRVDGGATVNKLLMQ
FQSDILNVKVVKSKISELTAAGAAYLAGLAVNYWNSLEEIQDKWQLEQVFKPKRMSSRLE
RIQGWKKAIKTTRSWSSQIK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgaaaaaatatgtgttatcattagatcagggaactaccagttctcgagctatt
atttttgataaaattggaaatattatttccatagctcaaagagaatttacacaaatttat
cctcatcctggatgggtagaacacaatgcagaagaaatatggtcaacgcaagcttcagtt
gctttagaagctgttttaaagggaaatttagaaggtgaaaatattatatctataggaata
actaatcaaagagaaaccactgttgtatgggacagaaaaacgggagaacctatttttaat
gctatagtatggcaagatagacgtacaataaaatattgtgatcaaattaaaaaagaagga
ttaaccgaaatgattcgaaaaaaaacaggattgattatagatccttatttttccgctaca
aaaattaaatggatattagaaaacgttcctggggcaaagaaaaaagcttattctggatct
ttagcatttggaacaatagattcatggttaatatggaatttaaccggtaaagaaattcat
gtaacagatgttactaatgcttctcgcaccatgttatttaatattcacacgcttagttgg
gatcaagagttgatagatttatttaatattccagtaaatatgcttccagaagtaaaatcc
tctagtgaaatttttggttatacaacaggacatattctatcacataaaatcccaatatct
gggattgctggagatcaacaagcagctctttttggtcaaatgtgtactaaaattggaatg
gtgaaaaatacttatggaacaggatgttttatgttaatgaatgtaggggatcatcctgtt
ttttctcaaaataatttaattactactgttgcttggaaaattaagaatcaagttcaatat
gcgttagaaggaagtgtttttattgcaggagctgttgttcaatggcttagagatggattg
ggacttcttttatcttctaatgaagcggaaatattagcttcttcagtagataatacagaa
gggttatatatggttccagctttttcaggtttaggtgctccttattgggatcaaaaagct
agaggaacaattgtgggtataacaagaggaacttcttcggctcattttgttcgagcagca
ttagaaagtattgcttttcaaaatatggatgtactgaaagctatggaagctgattctgga
attttgataaaagaacttcgtgtagatggaggtgccacggtaaataaattattaatgcaa
tttcaatctgatattttaaatgtgaaagttgttaaatctaaaatttcagaactcacagct
gctggagcggcttatttagccggattagctgttaattattggaatagtcttgaagaaatt
caagataaatggcaattggaacaggtttttaaaccaaaaagaatgtctagtagattggaa
cgaattcaaggatggaaaaaagcaatcaaaacaactcgttcttggtctagtcaaataaaa
taa

DBGET integrated database retrieval system