KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_187Help
Entry
BGIGA_187         CDS       T02109                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bbg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bbg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207187..207684
Genome map
AA seq 165 aa AA seqDB search
MKIVLIAAISENGFIGKNNQLMWHLPNDLKRFKNLTMGETIIMGRKTFESIGKILPKRKN
IILTKNKMNFLYLKNKKNIRIVSSIKEIENLTCKKIFVIGGEKTYASTIEKANIIELTLI
HKKFHGDTKFPKIDTKKWKKTCEFVYEKDKYHLFNYSFIRFERKK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttttgattgctgctatttcagaaaatggatttataggaaaaaataatcaa
ttaatgtggcatttacctaatgatttaaaacgttttaaaaatttaactatgggagagaca
attataatgggaagaaaaaccttcgaatccattggaaaaatacttccaaaaagaaaaaat
attatactaacaaaaaataaaatgaattttttatacttgaaaaataaaaaaaatattaga
attgtttcttctatcaaagaaatagaaaatttaacatgcaaaaaaatatttgttatagga
ggagaaaagacatatgcctctacaattgaaaaagcaaatatcatagaattaacattaatt
cataaaaaatttcatggagacacaaaatttccaaaaatagacacaaaaaaatggaaaaaa
acgtgtgaatttgtttacgaaaaagataaatatcatttatttaactacagttttattaga
tttgaaagaaaaaaataa

DBGET integrated database retrieval system