KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_202Help
Entry
BGIGA_202         CDS       T02109                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00340  Histidine metabolism
bbg01100  Metabolic pathways
bbg01110  Biosynthesis of secondary metabolites
bbg01230  Biosynthesis of amino acids
Module
bbg_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BGIGA_202 (hisD)
Enzymes [BR:bbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BGIGA_202 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFJ90653
UniProt: I3QGB8
Position
complement(219878..221173)
Genome map
AA seq 431 aa AA seqDB search
MNMIQVYIHPPEKTWKSISNRALQNISHLKNLVDPIIDNVKIYGDVALKAYTKKYDHADI
KCIQVTEEDLDKAHVKISNRLKKSIDIAYQNIKHFHQKQIYEEPSVEISKGISCWRKTIP
IEKVGFYIPGGSAPLLSTVLMLGIPGKLSGCKNIILCSPPNKDGEIHPSILYTAKYVGIT
RIYKVGGAQAIASMAYGTESIPSVYKIFGPGNSYVTIAKQIVFQKGIVSIDMPAGPSEVA
IMADDTANPEYVAADLLSQSEHDSESYILLVTTNNQSWVEEVKKELKKQFLDIFYNKRDI
VKKSLKKSKIIVLTSLDKCLTLLNQIAPEHLIINCKNASYWGEKVINAGSVFLGNYSPVS
AGDYASGTNHVLPTYGYAKYYSGLSIDSFVKKITFQKISKKGLKNLSECVNVLSSEEGLL
AHKKSINIRLK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgattcaagtatatattcaccctccagaaaaaacatggaaatctatttcaaat
agagctttacaaaatatttctcacttaaaaaatttagtggatcctattattgataatgtt
aaaatttatggagatgttgctttaaaagcttatacaaaaaaatatgatcatgcagatata
aaatgcattcaagtcacagaagaagatttagataaagctcatgtgaaaatttcaaatcgt
ttaaaaaaatctattgacattgcatatcagaatataaaacattttcatcaaaaacaaata
tatgaggaaccttcagtagaaatttcaaaaggaatttcttgttggagaaaaacaattcca
atcgaaaaagtaggtttttatattccaggaggatctgctcctttattatctactgtgtta
atgttaggaattcctggaaaattatcaggatgtaaaaacattatattatgtagcccccca
aataaagatggagaaattcatccatctattttatacacagctaaatatgtaggaattaca
cgtatatataaagtaggaggagcacaagcaattgcatctatggcttatggaactgaaagt
attccttctgtatacaaaatatttggtcctggaaattcttatgtcacgattgctaaacaa
attgtattccaaaaaggaattgtatctatagatatgccagcaggaccttcggaagtagca
attatggctgatgatacagcaaatccagaatacgttgctgctgatttattatctcaatct
gagcatgattcagaaagttatattcttttggttaccacaaataatcaatcttgggtagaa
gaagttaaaaaagaattaaaaaaacaatttttggatattttttataataagcgagatatt
gttaaaaaatctttgaaaaaaagcaaaataattgttcttacctctttagataaatgtttg
actttactaaatcaaattgctccagaacatttaattattaattgtaaaaatgcttcttat
tggggagaaaaagtaattaatgctggatctgtttttttaggaaattattctccagttagt
gcaggagattatgcttctggaacaaatcatgtattgcctacatatgggtatgccaaatat
tatagtggactatctatagatagttttgtaaaaaaaattacttttcaaaaaatatccaaa
aaaggattaaaaaatttatcggaatgtgtcaatgttttatcttctgaagaaggattatta
gcacataaaaaatctattaatattcgattaaaataa

DBGET integrated database retrieval system