KEGG   Blattabacterium BGIGA (Blaberus giganteus): BGIGA_210Help
Entry
BGIGA_210         CDS       T02109                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bbg  Blattabacterium BGIGA (Blaberus giganteus)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BGIGA_210 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BGIGA_210 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BGIGA_210 (trpA)
Enzymes [BR:bbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BGIGA_210 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(226824..227591)
Genome map
AA seq 255 aa AA seqDB search
MNKIHNLFRNKNKDILCIYFTAGFPYVNSTVKIIKILQDLDVDLIEIGIPYSDPLADGMT
IQKSNQTSLNNGMNISLLFDQIEKFKEKIKIPIILMGYYNQFYQFGKDKFLKKCQESEIS
GLILPDLPIDIYLHEYQNIFEKYLLSMIFLVTPKTNLNRISMLSKISDGFLYIVSSISTT
GNVNPFGGEQISFFKQIKKLSINIPKLIGFGIRDKKTFDLSCRYANGGIIGSSFIQSLNK
NKLEESIIKYIKSIR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatacataatttatttagaaataaaaataaagatatattatgcatttatttt
acagcaggatttccttatgtaaatagtacagtaaaaatcataaaaatattgcaagatctt
gatgtggatttaattgaaataggaattccttattctgatcctctagcagatggaatgaca
atccagaaaagtaatcaaacttcgttgaataatggaatgaatatctctttattatttgat
caaatagaaaaatttaaagaaaaaataaaaattcctattattcttatggggtattataat
caattttatcagtttggaaaagataaatttttgaaaaaatgtcaagaatcagaaatttcc
ggattaattttaccggatcttccaattgatatttatttgcatgaatatcaaaatatattt
gaaaaatatttgttatctatgatatttttagttactccaaaaaccaatttgaatagaata
tctatgttaagtaaaattagtgatggatttttatatattgtttcttctatttctacgaca
ggaaatgttaatccttttggaggggaacaaatatctttttttaaacaaatcaaaaaattg
tctataaatattccaaaattgattggttttgggataagagataaaaaaacttttgattta
tcatgtcgatatgctaatggagggatcattggaagttcttttattcaatcattgaataaa
aataaattggaagaaagtataataaaatatataaaatctattagatag

DBGET integrated database retrieval system