KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_211Help
Entry
BGIGA_211         CDS       T02109                                 

Gene name
trpB
Definition
(GenBank) bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00260  Glycine, serine and threonine metabolism
bbg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbg01100  Metabolic pathways
bbg01110  Biosynthesis of secondary metabolites
bbg01130  Biosynthesis of antibiotics
bbg01230  Biosynthesis of amino acids
Module
bbg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BGIGA_211 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BGIGA_211 (trpB)
Enzymes [BR:bbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BGIGA_211 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFJ90661
UniProt: I3QGC6
Position
complement(227584..228777)
Genome map
AA seq 397 aa AA seqDB search
MKYFVDKNGYYGEFGGTFIPEMLYHNVIELQCKYKKFITSYEYQKIYKKLLKNYVGRPTP
LFLCKKYSDQYHAKIYLKREDLNHTGSHKINNAIGQALLAIKLGKKKIVAETGAGQHGVA
TATVCALMHLECIIFMGEKDIQRQYSNVIKMKGLGAEVVSVSSGNKTLKDAVNEAIRYWI
NHPESYYLIGSTVGPHPYPQMVADIQSIISEEVKVQLKEAEGFNFPNYVVTCIGGGSNAA
GSFYHFLENDSVHLVAVEAAGLGITTKKTASAIQCGSKGVLHGSMTFILQDKDGQVLPAY
SISPGLDYPGIGPMFANLFVKKRVNFLHSTDEEALQAGYELIRSEGIIPALESAHALAAL
KKISFKENDVVIVTLSGRGDKDIDIYNKFFVKLSKNE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattttgttgataaaaatggatattatggagaatttggaggaacttttattcct
gaaatgttatatcataacgtaatagaactacaatgtaaatataaaaaatttattacaagt
tatgagtatcaaaaaatatataaaaaattgttaaaaaattatgtaggaagacctactcct
ttatttttatgcaagaaatattcagatcaatatcatgctaaaatttatcttaaaagagaa
gatttaaatcatacaggatctcataaaattaataatgccataggtcaagctttattagca
ataaaattagggaaaaaaaaaattgtagcggaaacaggtgcaggacaacacggagtagca
acggcaactgtttgtgctttaatgcatttagaatgtataatttttatgggagaaaaagat
atccaacggcaatatagtaatgttataaaaatgaagggattaggagctgaagttgtttcg
gtttcaagtggaaataaaacgttaaaagatgctgtgaatgaagctattcgttattggata
aatcatccagaaagttattatttaataggttctacagtagggcctcacccttaccctcaa
atggttgcagatattcaatctattataagtgaagaagttaaagttcaattaaaagaagca
gaaggatttaattttcctaattatgtagtgacttgtattggaggaggaagtaacgctgca
ggatctttttatcattttttagaaaatgattcggttcatcttgtggcggtagaagctgca
ggattaggtattacaacaaaaaaaacggcttcagctattcaatgtggatctaaaggagta
ttacatggaagtatgacatttattttacaggacaaagacggtcaagttcttcctgcttat
tctatatctccagggttagattatcctggaattggacctatgtttgcgaatctttttgta
aaaaaacgtgtaaattttttacattctacagatgaagaagctttgcaagcgggatatgaa
ttaatccgatcagaaggaattattcctgctctagaaagtgcacatgcattagctgcatta
aaaaaaatctcatttaaagaaaatgatgtagtaatcgtgactttatctggaagaggggat
aaagatattgatatttacaataaattttttgttaaattatcaaaaaatgaataa

DBGET integrated database retrieval system