KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_213Help
Entry
BGIGA_213         CDS       T02109                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bbg01100  Metabolic pathways
bbg01110  Biosynthesis of secondary metabolites
bbg01130  Biosynthesis of antibiotics
bbg01230  Biosynthesis of amino acids
Module
bbg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BGIGA_213 (trpC)
Enzymes [BR:bbg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BGIGA_213 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AFJ90663
UniProt: I3QGC8
Position
complement(229453..230250)
Genome map
AA seq 265 aa AA seqDB search
MMNILDKIVYVKQKEVYKNKIICPIKKLENSSFFERKIFSLVKNIRKSYTGIIAEFKCKS
PSKGIINNKASVEKVVKDYVYAGVSGISILTDQHFFSGKNEDLKKSRSVASIPILRKDFI
IDEYQIIESKSMGADVILLIAGILSKNQIANFSKIAKSINLEVIIEIHNEFEIDKITDNL
DIIGINNRNLKTFIVDYNNCLKLSSKIPNSYVKIAESGIDDINHILKLRKQGFKGFLIGE
YFMKEKDPGKVCKYFIESLSRKDTN
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatattcttgataaaattgtatatgtaaaacaaaaagaagtatacaaaaataaa
attatatgtcctataaaaaaattagaaaatagttctttctttgaaagaaaaattttttct
ctagtaaaaaatataagaaaaagttatacgggtatcattgcagaatttaaatgcaaatct
ccatctaaaggaatcattaataataaagcatcagttgaaaaagtagttaaggattatgtc
tatgcaggagtaagtggaatatctattcttacagatcaacattttttttccggtaaaaac
gaagatttaaaaaaatcacgttctgtagcttctattcctatattaagaaaagattttatt
attgatgaatatcaaattatagaatctaaatctatgggagcggatgttatattgttgatt
gctggaattctttctaaaaatcaaatagccaatttttctaaaattgcaaaaagtatcaat
ttagaagtcattattgaaattcataatgaatttgaaattgataaaataacagacaattta
gatattataggaattaataatcgtaatttgaaaacttttattgtggattataataattgt
ttaaaattatcttcaaaaattcctaatagttacgtaaaaattgcagaaagtggaattgat
gatataaatcacatattaaaattaaggaaacaaggatttaaaggttttttaattggagaa
tattttatgaaagaaaaagatcccgggaaagtttgtaaatattttatagaatctttatca
agaaaagatactaattaa

DBGET integrated database retrieval system