KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_336Help
Entry
BGIGA_336         CDS       T02109                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bbg00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
364595..365209
Genome map
AA seq 204 aa AA seqDB search
MILNKTKLGKIMKKGKMIILSGPSGSGKTTISHYLLSKFPELKFSVSCTTRSIRNNEIHG
KDYYFLSVNSFIYKIKKCQFAEWEEVYPNLFYGTLKNEISKIWKSNQHILFDIDVKGGLN
LKKKYPNNSLSIFVTVNSINILKKRLIARCYKNNTNINTRLNKVQEENSYAKLFDFILFN
IDLYQTKKKAIQIVSNFIYGKQSE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatattaaacaaaacaaagttaggcaaaataatgaaaaaaggaaaaatgattattctg
tcaggcccttctggatctggaaaaacaaccatttcgcattatttactttcaaaatttccg
gaattaaaattttctgtttcatgcacaacgcgatcaattcggaataatgaaatacatgga
aaagattattattttttatctgtaaactcttttatttataaaataaaaaaatgccaattt
gcagagtgggaagaagtttatccaaacttattttatggaaccttaaaaaacgaaatttcc
aaaatttggaaatctaatcaacatattttatttgatatagatgtaaaaggaggattaaat
ttaaaaaaaaaatacccaaataattctttatccatatttgtaacagtaaattctataaat
attttaaaaaaaagacttattgcaagatgttataaaaataatacgaacatcaacactcgt
ttaaataaggttcaagaagaaaatagttatgctaaattgtttgactttattttattcaat
attgatttgtatcaaactaaaaaaaaagcgattcaaatagtttccaattttatttatgga
aaacaatcggagtga

DBGET integrated database retrieval system