KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_522Help
Entry
BGIGA_522         CDS       T02109                                 

Gene name
tpiA
Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bbg01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbg01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbg00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bbg00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(538757..539515)
Genome map
AA seq 252 aa AA seqDB search
MRKKVFIANWKMNYDFHETTFFIRNLLKIVFERKINHNKEIILAPSFPFLHISNQILQGT
NLNIAAQNIHHKDKGSYTGEVSAYMLKSIGVKNVILGHSERREFFFEENNVLSEKIKIAL
KYDLNIIFCVGESFYERSNDQQFHIVKHQLKETVFQCSSDKIKSFYIAYEPIWAIGTGKT
ATFEQAQTMHKFIRNLFLEKYGESISNKISILYGGSLNDINAKDFFYQKDIDGGLIGNSS
LKLEKFLKIVQS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaggttttcatcgcaaattggaaaatgaattatgattttcatgaaacaact
ttttttatcagaaatttattaaaaattgtttttgaaagaaaaataaatcataataaagaa
attattttagcaccctcttttccttttttacatatttcaaatcagattttacaaggtaca
aatttaaatattgcggctcaaaatatacatcataaggataaaggttcctatacaggagaa
gtatcagcttatatgttaaaatctataggagttaaaaatgttatattaggacatagtgaa
cgcagagaatttttttttgaagaaaataatgttttatcagaaaagataaaaatagcatta
aaatatgatctaaatattattttttgtgtaggagaatcgttttatgaaagatctaatgat
caacaatttcatatagtgaaacatcaattaaaagaaactgtttttcaatgttcttcagat
aagataaaatctttttatatcgcatacgaacctatatgggcaattggaacaggaaaaact
gctacatttgaacaagctcaaactatgcataaatttattcgtaatttatttttagaaaaa
tatggagaaagtatttctaacaaaatatctattttgtatggaggaagtcttaatgatatt
aatgcaaaagattttttttatcaaaaagatatagatggaggtctgataggaaactcatct
cttaaacttgaaaaattcttgaaaatagttcaatcataa

DBGET integrated database retrieval system