KEGG   Blattabacterium sp. (Blaberus giganteus): BGIGA_528Help
Entry
BGIGA_528         CDS       T02109                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acyltransferase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbg  Blattabacterium sp. (Blaberus giganteus)
Pathway
bbg00010  Glycolysis / Gluconeogenesis
bbg00020  Citrate cycle (TCA cycle)
bbg00620  Pyruvate metabolism
bbg01100  Metabolic pathways
bbg01110  Biosynthesis of secondary metabolites
bbg01120  Microbial metabolism in diverse environments
bbg01130  Biosynthesis of antibiotics
bbg01200  Carbon metabolism
Module
bbg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BGIGA_528 (aceF)
   00020 Citrate cycle (TCA cycle)
    BGIGA_528 (aceF)
   00620 Pyruvate metabolism
    BGIGA_528 (aceF)
Enzymes [BR:bbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BGIGA_528 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding CAT Biotin_lipoyl_2 KH_5 PYNP_C Phenol_monoox
Motif
Other DBs
NCBI-ProteinID: AFJ90956
UniProt: I3QH71
Position
544177..545316
Genome map
AA seq 379 aa AA seqDB search
MAEIISMPQLSDTMKEGTVIKWNKKIGEKVSEGDILAEIETDKATQDFEIDVSGILLFIG
VKEGETTRVNDVLAIIGNEGEDISHIISKLESKKIEQEDQKKNNEKIFISPIAKRMAKKM
GISINKIKGSGEYGRIIKKDIEFYEKQNLDKIEAQNTIHSSIRKKIAEHLTYSKFSAPHY
YLFSEINADKLIEFRKNLNDKFPLEEKISFNDIIIKAVAQSLKKHPDINVSWNDEKIIIH
PHIHIGIAVAIKDGLIVPVIKNADQKSLLQISKEIKDKASRSKLKKIQPEEIENSTFTVS
NLGMYGIESFTSIINTPNTSILSVGSIMIRPIVKNYKIDIGNIMKITLSCDHRIIDGAKG
SEYIHSLKNFLEDPITILF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaataatatctatgccccaattaagtgatacaatgaaagaaggaactgtaatc
aaatggaataaaaaaataggggaaaaagtttcagaaggggatattttggctgaaatagaa
actgataaagctacccaagattttgagatagatgttagtggaattttactttttatcgga
gtaaaagagggagaaaccactcgtgtaaatgatgtattagcaattataggaaatgaaggg
gaagatatcagtcatataatttctaaattagaatctaaaaaaatagaacaagaggatcaa
aaaaaaaataacgaaaaaatatttatctctcctatagcaaaaagaatggcaaaaaaaatg
ggtatttctataaataaaataaagggaagcggagaatatggaaggattattaaaaaagac
atagaattttatgaaaaacaaaacctagataaaatagaagcccaaaatactattcattct
tctattagaaaaaaaatagcagaacatttgacttattccaaattctcagctccacattat
tatttgtttagtgaaattaatgcggataaattaattgaatttcgaaaaaatttaaatgat
aaatttcccttagaagaaaaaatatcattcaatgacatcattatcaaagctgtggctcaa
tctttaaaaaaacatcctgatataaatgtatcatggaacgatgaaaaaattataatacat
ccacatattcatattggtattgctgtggctataaaagacggattaattgtaccagttatt
aaaaatgcagatcaaaaatcattgctacaaatttccaaagaaattaaggataaagcatct
cgttcaaaattaaaaaaaatacaaccggaagaaatagaaaatagtactttcaccgtttca
aatttaggaatgtatggaatagaatcttttacttctattataaatacacctaatacatct
atattatctgtaggatctattatgattcgtcctatcgtgaaaaattataaaattgatata
ggaaatatcatgaaaattacattatcttgtgatcatcgaattatagacggagctaaagga
agtgaatatattcattctcttaaaaattttttagaagatcctattactatattattttaa

DBGET integrated database retrieval system