KEGG   Blattabacterium BGIGA (Blaberus giganteus): BGIGA_567Help
Entry
BGIGA_567         CDS       T02109                                 

Gene name
speB
Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bbg  Blattabacterium BGIGA (Blaberus giganteus)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bbg00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BGIGA_567 (speB)
Enzymes [BR:bbg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BGIGA_567 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
588176..589054
Genome map
AA seq 292 aa AA seqDB search
MKFHYRNKKKTFAGIPKKYATLDQSKTVLIPVPYDYTQTWKKGAKKGPKAFLSAAEHMEL
YDIETNSEVYKKGIFLVPYIINSSVSTKKMIEKVYNVTKKFLSKEKFITFIGGDHSISIG
SIRAFGEKYTNLSILHMDAHTDLRPMYKGSPYNHACSMYEASKKYPLIQIGIRSMDIMEK
KYIQKENIFYMHKIYQNDLWMQNAIHKLSNNVFISIDIDVFDPSIAPSTGTPEPGGLSWY
TTLKFLKKVFNKKNVIGFDIVELLPNKNESSTDFLAVKLYYKLLSYKHVNVN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatttcattatagaaataaaaaaaaaacttttgcgggaattcctaaaaagtacgcc
acacttgatcaatctaaaacggtgcttattccagttccatatgattatactcaaacatgg
aaaaaaggggctaagaaaggacctaaagcttttttatctgccgcagaacatatggaatta
tatgatattgaaaccaattcagaagtatataaaaaaggaatttttcttgttccctatatt
ataaattcttcagtttccacaaaaaaaatgattgaaaaagtatataatgttacaaaaaaa
tttctttctaaagagaaattcataacatttataggaggagatcattctatatcaatagga
agtattagagcttttggagaaaaatatacaaatttaagcattcttcatatggacgcgcat
acagatttgcgtcctatgtataaaggaagtccttataatcacgcttgttccatgtatgaa
gcttccaaaaaatatcctttaatacaaataggaattcgtagtatggatataatggagaaa
aaatatattcaaaaagaaaatatattttatatgcataaaatttatcaaaatgatttatgg
atgcaaaatgctattcataaattatctaataatgtatttatcagtatagatatagatgtt
tttgatcctagtatcgccccttctacaggtactccagaaccaggagggttatcttggtac
acaactttaaaatttttgaaaaaagtttttaataaaaaaaatgtaataggatttgatatt
gttgaacttttacctaataaaaatgaatcttctacagattttctagctgtaaaactttac
tataaattattatcatataaacatgtaaatgtaaattaa

DBGET integrated database retrieval system