KEGG   Bordetella bronchiseptica 253: BN112_0354Help
Entry
BN112_0354        CDS       T02344                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00010  Glycolysis / Gluconeogenesis
bbh00020  Citrate cycle (TCA cycle)
bbh00620  Pyruvate metabolism
bbh01100  Metabolic pathways
bbh01110  Biosynthesis of secondary metabolites
bbh01120  Microbial metabolism in diverse environments
bbh01130  Biosynthesis of antibiotics
bbh01200  Carbon metabolism
Module
bbh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN112_0354 (aceF)
   00020 Citrate cycle (TCA cycle)
    BN112_0354 (aceF)
   00620 Pyruvate metabolism
    BN112_0354 (aceF)
Enzymes [BR:bbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN112_0354 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 RnfC_N HlyD_3 CAT
Motif
Other DBs
NCBI-GeneID: 13977412
NCBI-ProteinID: YP_006966440
UniProt: A0A0C6P162
Position
363890..365557
Genome map
AA seq 555 aa AA seqDB search
MSNIVEIKVPDIGDFKEVEVIEVLVSAGDTIKAEQSLITVESDKASMEIPASAAGVVKSV
KVKVGDKIAEGTVILEVEAAGEAAAAPKAEQAPEAAEAPKADAAKAEAPQAEAPAAAGPI
EVKVPDIGDFKEVEVIEVLVAEGDTIKAEQSLITVESDKASMEIPASAGGVVQSLKVKVG
DKVAMGTVIAVVQGQGAAAPAAKAEAPAAAEPAASAPASASAPAPAPAPAPAPAQRPAPA
AALQDEDLKPGQLPHASPSVRKFARELGVNLSRVTGSAAKGRITADDVRAYVKQALSAGA
PAGASGGGDGAALGLLPWPKIDFTKFGPIEAKPLSRIKKISGANLHRNWVMIPHVTNNDE
ADITDLEALRVALNKENEKSGVKVTMLAFLIKAVVAALKKFPEFNASLDGDNLVLKQYYH
IGFAADTPNGLVVPVVRDADKKGILELARETSELARKAREGKVSPAEMQGGCFSISSLGG
IGGTHFTPIINAPEVAILGVSRSAHKPVWDGKQFVPRLTLPLSLSYDHRVIDGASAARFN
AYLGQLLADFRRIAL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatatcgtggaaatcaaggtaccggacatcggtgacttcaaggaggtggaagtc
atcgaggtgctggtatcggcgggcgacacgatcaaggccgagcaaagcctgatcacggtg
gagtccgataaggcatcgatggagattccggcctcggccgcgggcgtggtgaagtcggtc
aaggtcaaggtgggcgacaagatcgccgaaggcacggtcatcctggaagtggaggcggcc
ggcgaggccgccgccgcgcccaaggccgagcaggcccccgaggccgccgaggcgcccaag
gccgacgccgcgaaggccgaggcgccccaggccgaggcgccggccgccgccggcccgatc
gaagtcaaggtgcccgatatcggcgacttcaaggaagtcgaggtcatcgaggtgctggtc
gccgagggcgacaccatcaaggccgagcaaagcctgatcacggtggagtccgacaaggcc
tcgatggaaatcccggcctcggcgggcggcgtggtgcagtcgctcaaggtcaaggtaggc
gacaaggtcgcgatgggcacggtcatcgccgtggtgcagggccagggcgcagccgccccg
gccgccaaggccgaggcgccggcggcagccgagcctgccgcgtcggccccggcttcggct
tcggctccggccccggccccggcgccggctccggctccggcgcagcggcccgccccggcc
gccgcgctgcaggacgaagacctcaagcccggccaattgccgcatgcctcgccgtcggtg
cgcaagttcgcgcgcgagctgggcgtgaacctgagccgcgtcaccggctcggccgcgaag
ggccgcatcacggccgatgacgtgcgcgcctacgtgaagcaggcgctgtcggccggcgcg
ccggctggcgcctcgggcggcggcgatggcgccgcgctggggctgctgccgtggcccaag
atcgatttcaccaagttcggccccatcgaagccaagccgctgtcgcgcatcaagaagatc
tcgggcgccaacctgcaccgaaactgggtcatgatcccgcacgtcaccaacaacgacgaa
gcggacatcaccgacctggaggcgctgcgcgtggcgctgaacaaggaaaacgagaaatcg
ggcgtcaaggtcaccatgctggccttcctgatcaaggcggtggtcgcggcgctgaagaaa
ttccccgagttcaacgcctcgctggatggcgacaacctggtgctcaagcagtactaccac
atcggcttcgccgccgacacgcccaacgggctggtggtgccggtggtgcgcgacgccgac
aagaagggcatcctggagctggcccgcgaaacctccgagctggccaggaaggcccgcgaa
ggcaaggtctcgcccgccgagatgcagggcggctgcttctcgatctcgtcgctgggcggc
atcggcggcacgcatttcacgcccatcatcaacgcgcccgaagtggccatcctgggcgtg
tcgcgctcggcccacaagccggtctgggacggcaagcagttcgtgccgcgcctgaccctg
ccgctgtcgctgtcctatgaccaccgcgtcatcgacggcgcttcggcggcgcgcttcaac
gcctatctcggccagctgctggccgacttccgccgcatcgcgctgtaa

DBGET integrated database retrieval system