KEGG   Bordetella bronchiseptica 253: BN112_0523Help
Entry
BN112_0523        CDS       T02344                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bbh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(536619..537602)
Genome map
AA seq 327 aa AA seqDB search
MPSPSALHDLCDTPPTFMGVPHRHAIDGARAAILGIPFDCGTHAFRIGARQGPQSIREQS
RLMRTFNPELADYNPLQRLGVIDCGNVRVVPSDILDAFERIEQAVGAIVDGGAVPVTMGG
DGSVSLPQLRAVGKRHPGLAVIHLDSHTDTNTFVKGKEYNAGTQFTHAALEGRVDTSLAF
HIGTRGTTFTQHVFRHARHFGYQIIPLNELLARGMAEVLQDLRARLGERPVYLCLDMDVL
DPSCAPGVCAPSWGGLSAREAIAFLRGLAGLNIVAIDVNTVSPPHDVNGTTASLAAALMV
EGLVLLCKRLGLDHPDPAPDFAAMYAR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccatcccccagcgcgctgcatgacctgtgcgacacgccacctaccttcatgggcgtg
ccccatcgccatgccatcgacggcgccagggcagccatcctcggcatccccttcgattgc
ggcacgcacgcgtttcgcatcggcgcgcgccagggcccgcagtcgatccgcgaacagtcg
cgcctgatgcgcaccttcaaccccgaactggccgactacaacccgctgcagcggctcggg
gtgatcgactgcggcaacgtgcgcgtggtgcccagcgacattctcgatgccttcgagcgc
atcgagcaggcggtcggggccatcgtcgatggcggcgcggtgccggtcaccatgggcggc
gacggcagcgtgtcgctgccgcaactgcgcgcggtcggcaaacgccatccgggcctggcc
gtcatccacctcgactcgcacaccgacaccaacaccttcgtcaagggcaaggaatacaac
gccggcacgcagttcacgcacgccgccctggaaggccgcgtggacacctcgctggcgttt
catatcggcacgcgcggcaccaccttcacccagcatgtgttccgccatgcgcgccacttc
ggctaccagatcatcccgctcaacgagctgctggcgcgcggcatggccgaagtgctgcag
gacctgcgcgcgcgcctgggcgaacggccggtctacctgtgcctggacatggacgtgctg
gatccgtcctgcgcgcccggggtatgcgcgcccagctggggcggcctgagcgcgcgcgag
gcgatcgcgttcctgcgcgggctggccggcctgaacatcgtcgccatcgacgtcaatacg
gtcagcccgccgcacgacgtcaatgggaccacggcatcgctggcggccgcgctgatggtc
gaaggcctggtgctgctgtgcaagcgcctggggctggaccatcccgacccggcgcccgac
ttcgccgccatgtacgcgcgctga

DBGET integrated database retrieval system