KEGG   Bordetella bronchiseptica 253: BN112_0669Help
Entry
BN112_0669        CDS       T02344                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bbh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
692102..694120
Genome map
AA seq 672 aa AA seqDB search
MSENQALARLCALAGVSPRWTDVWGRTRDVAPPVLRAVLAALDLPAATPAQTADTLARWR
ARPPAMLTARAGGMLRVPGDTATRYAIELDDGQVAHGLAEPDGAGGLALRAPRQPGYHTL
RLGSASIALAVAPPRAPTLARLLASPRPRRWGVAAQIYSLRGTADPDCGHGDFGALAELA
VAAAGHGADAVALSPAHALFAAAPRRCSPYSPSTRLFLNILYADPLDTFSDAECAAARRP
SSGADGPLIDWPQAAGARLAMLRRLHRGLAADDPRAAELARFRAEGGQALRDHALFEALH
AANGATDWRGWPAAWRRPAAALAAGCAREHAREMDFHVFAQWLARRSLAHAQAAARAAGM
GVGLIADLAVGVDPAGSQTWAQPDAMLGGLNVGAAPDLRHPGGQDWRLTACSPATLATQG
YAAYIDMLRRALASAGGVRIDHVLGLARLWVIPEGAPPDQGAYLAFPVEDLLRLAALEAW
RHRAVLIGENLGTVPRDFNARLRAHGVLGMDVLWLQRETGPGGAGRFRPPGRWPASAVAM
TSTHDLPTLRGWWQARDLDWCVPAHEADAQRRQRDQDRRALWRQAAPPGLAATAPPAEPP
CAALLSHVARSRAPLMLVPLEDLAGLAEQPNVPGCPDHPNWRRRMPATAAAMLVQPAARL
ALAAIAAHRGRP
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaaccaggccctcgcccggctgtgcgcgctggcgggcgtctcgccgcgctgg
accgatgtatggggccgcacgcgtgacgtcgccccgccggtcttgcgcgcggtcctggcc
gcgctcgacctgccggcggccacgccggcccagaccgccgacaccctggcgcgctggcgc
gcccggcctcccgccatgctgaccgcgcgcgccggcgggatgttgcgcgtgcccggcgac
accgccacgcgctatgccatcgagctggacgacggccaggtggcgcacggcctggccgag
cccgatggcgccggcggcctggcgctgcgcgcacccaggcaacccggctaccacacgttg
cggctgggcagcgcgtccatcgccttggcggtcgcgccgccgcgcgcgcccacgctggcg
cgcctgctcgccagtccacggccgcgccgctggggcgtggccgcgcagatctacagcttg
cgcggcacggccgaccccgattgcggccatggcgatttcggcgcgctggccgaactggcg
gtcgccgcggcgggccacggcgccgacgcggtggcgctcagccccgcacacgcgctgttt
gccgccgctccgcggcgctgcagcccgtactcgccctccacgcggctgttcctcaacatc
ctgtacgcggacccgctcgacaccttcagcgacgccgaatgcgccgccgcgcgccggccc
tcgtccggcgccgacggccccctgatcgactggccgcaggccgcgggcgcgcggctggcc
atgttgcggcgcctgcaccgcggcctggccgccgacgacccgcgcgccgccgaactggcg
cgctttcgcgccgaaggcggccaggcgctgcgcgaccacgccctgttcgaggccttgcac
gcggccaatggcgccaccgactggcgcggctggccggcggcgtggcgccgccccgccgcg
gcgctggccgccggctgcgcgcgcgaacatgcgcgcgagatggatttccacgtctttgcc
cagtggctggcgcggcgcagcctggcgcacgcccaggccgccgcgcgcgcggcaggcatg
ggcgtgggactgatcgcagacctcgccgtcggggtggacccggccggcagccagacctgg
gcccagcccgatgccatgctcggcgggctgaacgtgggcgcggcgcccgacctgcgccac
cccggcgggcaggactggcgcctgaccgcctgctcgcccgccacgctcgccacgcaaggc
tacgcggcctacatcgacatgctgcgccgcgcgctggccagcgccggcggcgtgcgcatc
gaccacgtactcggcctggcgcgcctttgggtcatccccgagggcgcgccgcccgaccag
ggcgcgtacctggcctttccggtcgaagacctgctgcgcctggcggccctggaagcgtgg
cgccaccgcgccgtgctcatcggcgagaacctcggcacggtgccgcgggacttcaacgcg
cgcctgcgcgcgcacggcgtgctcgggatggacgtactgtggctgcagcgcgagaccggg
ccaggcggcgcgggacgctttcgcccgccgggccgctggcccgccagcgccgtcgccatg
accagcacgcacgacttgcctaccctgcgaggctggtggcaggcgcgcgatctggactgg
tgcgtgcctgcgcacgaggccgacgcgcagcgccggcagcgcgaccaggaccggcgcgcc
ctgtggcgccaggcggccccgcccggcctggccgctacggcgccgcccgccgagccgccc
tgcgccgccctgctgtcccatgtggcgcgcagccgtgcgccgctgatgctggtgccgctc
gaggatctggcggggctggccgaacagcccaacgtgccgggctgcccggaccatcccaat
tggcgccggcgcatgcccgcaaccgccgcggcgatgctggtgcagccggccgcgcgcctg
gcgctggcggcgatcgccgcgcaccggggacggccatga

DBGET integrated database retrieval system