KEGG   Bordetella bronchiseptica 253: BN112_0690Help
Entry
BN112_0690        CDS       T02344                                 

Definition
glutathione transferase (EC:2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN112_0690
Enzymes [BR:bbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN112_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715408..716193
Genome map
AA seq 261 aa AA seqDB search
MDMARPRGATRYHDGCPPAPPGIRSGRAMIDLYYWTTPNGHKITLFLEETGLPYRIHPVN
ISKGEQFQPEFLAIAPNNRIPAIVDQAPADGGAPIPLFESGAILLYLAEKTGQFIPADLR
GRADVLQWLFWQMGGLGPMAGQNHHFSAYAPERIPYAIERYVKETNRLYGVLDRQLAQRE
FVAGDYSIADMAAYPWIVPHERQGQDLNEFPNLKRWFEAIGARPATQRAYALADRINTKP
SVDTEESRRVLFGQTAANVRR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggacatggcgcgcccgcgcggcgcgacccgctatcatgacggctgcccgccggctccg
cccggcattcgctcaggacgcgccatgatcgatctctactactggacgactcccaacggc
cacaagatcacgctctttctcgaagagaccggcctgccttaccgcatacaccccgtcaac
atcagcaagggcgagcagttccagccggaattcctggccatcgcgcccaacaaccgcatc
ccggccatcgtcgatcaggcgccggccgatggcggcgcgccgatcccgctgttcgagtcc
ggcgccatcctgctgtacctggccgagaagaccggccaattcatccccgccgacctgcgc
gggcgcgccgacgtgctgcagtggctgttctggcagatgggcggactgggccccatggcc
ggccagaaccaccacttctcggcctatgcgcccgagcgcatcccctacgccatcgagcgc
tacgtcaaggaaaccaaccgcctgtatggcgtgctcgaccgccagctggcgcagcgcgag
ttcgtcgccggcgactactcgatcgccgacatggcggcctatccctggatcgtgccgcac
gagcgccagggccaggacctgaacgagtttccgaacctcaagcgctggttcgaggccatc
ggcgcccgcccggccacgcagcgcgcctacgcgctggccgaccggatcaacaccaagccg
tcggtcgacaccgaggagtcccgccgcgtgctgttcggccagaccgccgccaacgtgcgc
cgctga

DBGET integrated database retrieval system