KEGG   Bordetella bronchiseptica 253: BN112_0690Help
Entry
BN112_0690        CDS       T02344                                 

Definition
(RefSeq) glutathione transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
bbh  Bordetella bronchiseptica 253
Brite
Enzymes [BR:bbh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     BN112_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 13977748
NCBI-ProteinID: YP_006966772
UniProt: A0A0C6P2X9
Position
715408..716193
Genome map
AA seq 261 aa AA seqDB search
MDMARPRGATRYHDGCPPAPPGIRSGRAMIDLYYWTTPNGHKITLFLEETGLPYRIHPVN
ISKGEQFQPEFLAIAPNNRIPAIVDQAPADGGAPIPLFESGAILLYLAEKTGQFIPADLR
GRADVLQWLFWQMGGLGPMAGQNHHFSAYAPERIPYAIERYVKETNRLYGVLDRQLAQRE
FVAGDYSIADMAAYPWIVPHERQGQDLNEFPNLKRWFEAIGARPATQRAYALADRINTKP
SVDTEESRRVLFGQTAANVRR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtggacatggcgcgcccgcgcggcgcgacccgctatcatgacggctgcccgccggctccg
cccggcattcgctcaggacgcgccatgatcgatctctactactggacgactcccaacggc
cacaagatcacgctctttctcgaagagaccggcctgccttaccgcatacaccccgtcaac
atcagcaagggcgagcagttccagccggaattcctggccatcgcgcccaacaaccgcatc
ccggccatcgtcgatcaggcgccggccgatggcggcgcgccgatcccgctgttcgagtcc
ggcgccatcctgctgtacctggccgagaagaccggccaattcatccccgccgacctgcgc
gggcgcgccgacgtgctgcagtggctgttctggcagatgggcggactgggccccatggcc
ggccagaaccaccacttctcggcctatgcgcccgagcgcatcccctacgccatcgagcgc
tacgtcaaggaaaccaaccgcctgtatggcgtgctcgaccgccagctggcgcagcgcgag
ttcgtcgccggcgactactcgatcgccgacatggcggcctatccctggatcgtgccgcac
gagcgccagggccaggacctgaacgagtttccgaacctcaagcgctggttcgaggccatc
ggcgcccgcccggccacgcagcgcgcctacgcgctggccgaccggatcaacaccaagccg
tcggtcgacaccgaggagtcccgccgcgtgctgttcggccagaccgccgccaacgtgcgc
cgctga

DBGET integrated database retrieval system