KEGG   Bordetella bronchiseptica 253: BN112_0808Help
Entry
BN112_0808        CDS       T02344                                 

Gene name
tesA
Definition
acyl-CoA thioesterase I (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bbh01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
864913..865461
Genome map
AA seq 182 aa AA seqDB search
MVGDSLSAEYGLRRGSGWVPMLARRVSQQYPNYRVVNASISGDTTSGGLARLPALLRQHA
PAVVVLELGSNDALRGLALDMTERNLRAMAQASRQAGAAVLLVGMQIPPNYGRDYTQRFA
QVFPAVAEQEKARLVPFLMEGIATNRAMFQADGIHPNEDAQPALLDNVWPVLEPMLAQPA
AD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcgacagcctgtcggccgaatacggcctgcggcgcgggtccggctgggtgccc
atgctggcccggcgggtttcgcaacaataccccaactaccgcgtcgtcaatgccagcatc
agcggcgataccaccagcggcgggctggcgcgcctgccggcgctgctgcgccagcacgcg
ccggccgtcgtcgtgctcgaactgggctccaacgacgccctgcgcggcctggcgctggac
atgaccgagcgcaatctgcgcgccatggcgcaggcgtcgcgccaggccggcgccgcggtg
ctgctggtcggcatgcagatcccgccgaactatggccgcgactacacccagcgcttcgca
caggttttcccggccgtggccgaacaggaaaaagcccggctggtgccgttcctcatggaa
ggaatcgccaccaaccgggccatgttccaggccgacggcatccatcccaacgaggacgcc
cagccggcgctgcttgacaatgtctggcccgtgctcgagccgatgctggctcagcccgcg
gccgactga

DBGET integrated database retrieval system