KEGG   Bordetella bronchiseptica 253: BN112_0821Help
Entry
BN112_0821        CDS       T02344                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bbh  Bordetella bronchiseptica 253
Brite
Enzymes [BR:bbh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BN112_0821 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(877433..878122)
Genome map
AA seq 229 aa AA seqDB search
MPRAPAQPAPLASGNLGLNSDRLRQAMVQRLRTQGIVDERVLNAMAAVPRHLFVDEALAS
RAYEDAALPIGHSQTISQPWVVARMIAAVCEDRAPARVLEVGAGCGYQAAVLAQIVREVH
AIERIRGLYELARGHLRALRLATRVRLIHGDGMLGVPGVAPFDAIVVAAAGLAIPQALLD
QLAPGGRLIAPEGSTHQRLVLIERTGATAWSRKELEAVRFVPLRAGIQS
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcgcgcgcctgcgcagcccgcgccgctggccagcggcaacctgggcctgaactcc
gaccggctgcgccaggcgatggtgcagcggctgcgcacgcagggcatcgtcgacgaacgg
gtgctcaacgccatggcggcggtgccgcgccatctgttcgtcgatgaagcgctggccagc
cgtgcctacgaagacgcggcgctgcccatcgggcactcgcagaccatttcgcagccgtgg
gtggtggcccgcatgatcgccgccgtctgcgaggaccgtgccccggcccgggtgctcgag
gttggcgccggctgcggctaccaggcggcggtactggcccagatcgtgcgcgaggtgcat
gccatcgagcgcatccgcggcctgtacgagctggcgcgcggccatctgcgggcgctgcgc
ctggccacccgggtgcgcctgatccatggcgacggcatgctgggcgtgcccggcgtggcg
ccgttcgatgctattgttgtggctgcggcgggcctggccattccgcaggccttgctggat
cagcttgcgccgggcgggcggctgatcgcgcccgaagggtccacccaccagcggctggtg
ctgatcgaacgcaccggggccaccgcctggagccgaaaagaactcgaagctgtacgtttt
gtgcccctcagggccggaatacaatcttga

DBGET integrated database retrieval system