KEGG   Bordetella bronchiseptica 253: BN112_0880Help
Entry
BN112_0880        CDS       T02344                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BN112_0880
Enzymes [BR:bbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BN112_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(936354..937145)
Genome map
AA seq 263 aa AA seqDB search
MMSSSYTVQDKDVLRARVDREIESRVSEPQWTRAQKMALACRMLAEQGHWHGGLAGQITA
RGDEPGTYWTLPFGVGADEARASELILIDEDLNPLDGKSLPNPANRFHIWIYRHRPNVQC
IVHTHPPAVSALSMVGEPLVVAHMDATPFYNDCAYLPQWPGLPIGDNEGEVISAALGEKR
AILLANHGLLTAGSSIEESAVMALWMEQAAMLQLRARAIGPVKAVPGELAQESHDFLVKP
KIQSLTFAYFARRVLRAAPDCLD
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgtcttcttacacagtgcaggacaaggatgtattgcgcgcgcgcgtcgaccgc
gaaatcgagtcgcgcgtgagcgagccgcaatggacgcgcgcccagaaaatggcgctggcc
tgccgcatgctggccgagcagggccactggcatggcgggctggccggccagatcacggcg
cgcggcgacgagccgggcacgtactggacgctgccgttcggcgtgggcgccgacgaggcg
cgtgccagcgaactgatcctgatcgacgaggacctcaatccgctggacggcaaatcgctg
cccaatcccgccaatcgcttccacatctggatttaccggcaccggcccaacgtgcagtgc
atcgtccatacccatccgccggccgtctcggcgctgtcgatggtgggcgagccgctggtg
gtggcgcatatggacgccacgccgttctacaacgattgcgcctatctgccgcaatggccg
ggcctgcccatcggcgacaacgagggcgaggtgatttcggccgcgctgggcgagaagcgc
gccatcctgctggccaaccatggcctgttgaccgccggcagttcgatcgaggaatccgcc
gtcatggcgctgtggatggagcaggcggcgatgctgcaattgcgcgcgcgcgccatcggg
ccggtcaaggcggtgccgggcgaactggcgcaggaatcgcacgacttcctggtcaagccc
aagatccagtcgctgaccttcgcctatttcgcgcggcgcgtgctgcgggccgcgcccgac
tgcctggattga

DBGET integrated database retrieval system