KEGG   Bordetella bronchiseptica 253: BN112_1340Help
Entry
BN112_1340        CDS       T02344                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN112_1340
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BN112_1340
Enzymes [BR:bbh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BN112_1340
Lipid biosynthesis proteins [BR:bbh01004]
 Desaturase
  First
   BN112_1340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1432970..1434178)
Genome map
AA seq 402 aa AA seqDB search
MDSILSFISGGLTQATWWQIVLFTLVVTHITIVSVTVFLHRSQAHRGLDLHPAVMHFFRF
WLWMTTGMVTKEWVAIHRKHHAKCEKEGDPHSPMLFGIWKVLFRGAELYREESANKETMA
KFGHGTPDDWLERNIYSKHSLAGVLTMLAIDLALFGAVGLTVWAVQMAWIPFWAAGVVNG
IGHYWGYRNYNSPDTSTNVFPWGIIIGGEELHNNHHAHGTSAKFSAKWYELDIGWGYISI
LKFFGLAKVKKVAPKLKLESGSKGIDLSTLQGVITHRYEVMARYGDLVKRAAREELSKLK
SSRQQDAANCRWTTLRRVRRWLHRNEEVLQPEQRAEVDQAIAQNQSLSTLVQMRRELGRL
WESSSASSEQLLHDLQAWCQRAQQSGIAGLEQFALHLRRYAA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggattccatcctttctttcatttccggcggtctgacccaagccacttggtggcagatc
gtgctgttcaccctggtcgtgacgcacatcaccattgtgtcggtcacggtgttcctgcac
cgcagccaggcgcaccgcggcctggacctgcatccggcagtgatgcatttcttccgcttc
tggctctggatgaccaccggtatggtcaccaaggagtgggtcgccatccaccgcaagcac
cacgccaagtgcgagaaggaaggcgatccccattcgccgatgctgttcggcatctggaag
gtgctgttccgcggcgccgagctgtatcgcgaggagtccgccaacaaggaaaccatggcc
aagttcggccacggcacgcccgatgactggctcgaacgcaacatctattccaagcacagc
ctggccggcgtgctcaccatgctggccatcgacctggccctgttcggggcggtcggcctg
acggtctgggcggtgcagatggcctggatcccgttctgggcggccggcgtggtcaatggc
atcggccattactggggctaccgcaactacaacagcccggacaccagcaccaacgtgttc
ccgtggggcatcatcatcggcggcgaagagctgcacaacaaccaccacgcgcacggcacc
tcggccaagttctcggccaagtggtacgagctggacatcggctggggctatatcagcatc
ctgaagttcttcggcctggccaaggtcaagaaggttgcgcccaagctgaagctggaatcg
ggcagcaagggcatcgacctgagcacgctgcaaggcgtgatcacgcaccgctacgaagtc
atggcccgctacggcgacctggtcaagcgcgccgcgcgtgaagagctgagcaagctgaag
tcctcgcgccagcaggacgccgccaattgccgctggaccacgctgcgccgcgtgcgccgc
tggctgcaccgcaacgaggaagtcctgcagcccgagcagcgcgccgaagtcgaccaggcc
atcgcccagaaccagtcgctgtcgacgctggtgcagatgcgccgcgaactcggccgtctc
tgggaaagctccagcgccagcagcgagcagctgttgcatgacctgcaggcctggtgccag
cgcgcccagcaaagcggcatcgccgggctcgagcaatttgctctgcatctgcgccgctac
gcggcatga

DBGET integrated database retrieval system