KEGG   Bordetella bronchiseptica 253: BN112_1563Help
Entry
BN112_1563        CDS       T02344                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN112_1563
Enzymes [BR:bbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN112_1563
Transporters [BR:bbh02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN112_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 13978621
NCBI-ProteinID: YP_006967631
UniProt: A0A0C6P4B2
Position
1667239..1667850
Genome map
AA seq 203 aa AA seqDB search
MKLIGSLTSPYVRKVRVVMAEKKLDYQLELENVWSPDSQVQKYNPLGKVPCLVMEDGGAL
FDSRVIVEYLDTLSPVARLIPQPGRERAAVKCWEAIADGLLDACVTVVRERLRPAAQQSP
EWIERQYGKVRASLDAMDHSLGENAHCMGVNYSLADIAVGCALGYLDLRFADLDWRADHA
NLARLYEKLSARPSFVDSMPPTA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatcggctcacttaccagtccttacgtccgcaaagtgcgggtcgttatggca
gaaaagaagctggactaccagctcgagctggagaacgtctggtcgcctgattcgcaggta
cagaagtacaacccgctgggcaaggtaccctgcctcgtcatggaagacggcggcgcgctg
ttcgattcgcgcgtgatcgtcgaatacctcgataccctgtctccggtggcgcggctgatt
ccgcagccgggccgcgaacgcgcggccgtcaagtgctgggaagccatcgccgacggcctg
ctcgacgcctgcgtcaccgtcgtgcgcgaacgcctgcgcccggccgcgcagcaaagcccc
gaatggatcgagcgccagtacggcaaggtgcgcgccagcctggacgccatggaccacagc
ctgggcgaaaacgcccactgcatgggcgtgaactacagcctggccgacatcgccgtgggc
tgcgcgctgggctatctggacttgcgctttgcggacctggactggcgcgccgatcacgcc
aacctggcccgcctgtatgaaaagctgtcggcacgcccatccttcgtcgacagcatgccg
ccgaccgcctga

DBGET integrated database retrieval system