KEGG   Bordetella bronchiseptica 253: BN112_1721Help
Entry
BN112_1721        CDS       T02344                                 

Definition
enoyl-CoA hydratasee (EC:4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN112_1721
   01212 Fatty acid metabolism
    BN112_1721
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN112_1721
   00650 Butanoate metabolism
    BN112_1721
  Lipid metabolism
   00071 Fatty acid degradation
    BN112_1721
   01040 Biosynthesis of unsaturated fatty acids
    BN112_1721
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN112_1721
   00310 Lysine degradation
    BN112_1721
   00380 Tryptophan metabolism
    BN112_1721
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN112_1721
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN112_1721
   00281 Geraniol degradation
    BN112_1721
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BN112_1721
Enzymes [BR:bbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BN112_1721
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN112_1721
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BN112_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1866429..1868372
Genome map
AA seq 647 aa AA seqDB search
MNTPDLAYIHWRLHREADGLAWLALARADATANSLSAEVMAELAAVLDALQAQPPNGLVI
LSGKENGFIVGADINEFGALQTPQQARELVARGWQLFNRLAATPYPTLALIRGHCLGGGL
ELALACRYRIAADDADTALGLPEAMLGIFPGWGGMRRLPALIGAPAALDMMLTGRRVDAR
RAAALGLVDARVPPRLLQAAARATVLSGRAPRRARGLPAWLNRWPLKALAARRARQSVAA
KDPQGHYPAPRAIIDIWARHGGNALHAPDLIDGILASDTARQLLRVFRLQERLKGYGKAA
VDAPVRRVHVVGAGVMGGDIAAWCAYRGLTVTLQDQDMARIAPALARAGAFFARKLKDRR
AARAAFDRLVPDPQGDGVAQADLVIEAISENAQAKQALYRQLEPRLKPGALLATNTSSLS
LAGLAQVLDQPQRLVGIHFFNPVARMPLVEVVLAADGDPRALARACAFVGRIGKLPLPVR
DAPGFLVNAVLAPYMLEAMRCVDEGMAPAAIDAAMAAFGMPMGPLELADTVGLDIAAAAG
AQLTGEQAPPRCLAERLARKELGRKSGRGFYAWRDGKAVKPAARGVPPGLVDRLLQPLID
SARERVAAGVVADADLADAGAIFGTGFAPYTGGPLQYASQREAVQRP
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcccgacctggcctacatccactggcgcctgcaccgtgaagccgacggcctg
gcatggctggcgctggcgcgcgccgacgccaccgcgaactcgctgtcggccgaagtcatg
gccgaactcgccgcggtgctcgacgccctgcaggcccagccgcccaacggactggtcatt
ctgtcgggcaaggagaacggcttcatcgtcggcgccgacatcaacgaattcggcgcgctg
cagacgccgcagcaggcgcgcgaactggtcgcgcgcggctggcagctgttcaaccggctg
gcggcgacgccgtaccccacgctggcgctgatacgcggccactgcctgggcggcggcctg
gaactggcgctggcctgccgctaccgcatcgccgccgacgacgccgacaccgcgctgggg
ctgccggaagccatgctgggcattttccccggctggggcggcatgcggcgcctgccggcg
ctgatcggcgcgccggccgcgctggacatgatgctgaccggacgccgggtcgacgcgcgc
cgcgccgcggcgctgggcctggtcgacgcgcgcgtgccgccgcggctgctgcaggccgcc
gcccgcgccaccgtgctgtcgggccgagcgccgcgccgcgcgcgcggcctgccggcctgg
ctgaaccgctggccgctcaaggcgctggcggcgcgccgcgcgcgccagagcgtggccgcc
aaggatccgcagggccactaccccgccccgcgcgccatcatcgacatctgggcgcgccac
ggcggcaacgccctgcatgcgcccgacctgatagacggcatcctggcttcggacacggcg
cgccagctgctgcgcgtgttccgcctgcaggaacggctcaagggctacggcaaggccgcc
gtcgacgcgcccgtgcggcgcgtgcacgtggtgggcgccggcgtcatgggcggcgatatc
gccgcctggtgcgcctaccgcgggttgaccgtcacgctgcaagaccaggacatggcgcgc
atcgcgccggcgctggcgcgcgccggcgccttcttcgcccgcaagctgaaggaccggcgc
gccgcgcgcgccgccttcgaccgcctggttcccgacccccagggcgatggcgtggcgcaa
gccgacctggtcatcgaggccatcagcgagaacgcccaggccaagcaggccctctaccgc
cagctcgaaccgcgcctgaaaccgggcgccctgctggccaccaatacctccagcctgtcg
ctggccgggctggcccaggtcctcgaccagccgcagcggctggtcggcatccatttcttc
aacccggtggcgcgcatgccgctggtcgaagtcgtgctcgccgccgacggcgatccgcgc
gcgctggcgcgggcctgcgccttcgtcggccgcatcggcaagctgccgctgcccgtgcgc
gacgcgccgggtttcctggtcaatgcggtgctggcgccctacatgctggaagcgatgcgc
tgcgtcgacgagggcatggcgccggcggccatcgacgccgccatggccgccttcggcatg
ccgatggggccgctcgagctggccgacaccgtcgggctggacatcgcggcggccgccggc
gcccagctcaccggcgagcaagcgccgccgcgctgcctggccgaacgcctggcgcgcaag
gaactgggccgcaagagcggccgcggcttttatgcctggcgcgacggcaaggcggtcaag
ccggccgcgcgcggcgtgccgccagggctggtcgaccgcctgctccagcccctgatcgac
agcgcccgcgagcgcgtggccgccggcgtggtggccgatgcggacctggccgacgcgggc
gcgattttcggcacgggctttgccccctacacgggcggcccgctgcaatacgcaagtcaa
cgagaagccgtccagcggccttag

DBGET integrated database retrieval system