KEGG   Bordetella bronchiseptica 253: BN112_1721Help
Entry
BN112_1721        CDS       T02344                                 

Definition
(RefSeq) enoyl-CoA hydratasee
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00071  Fatty acid degradation
bbh00280  Valine, leucine and isoleucine degradation
bbh00281  Geraniol degradation
bbh00310  Lysine degradation
bbh00362  Benzoate degradation
bbh00380  Tryptophan metabolism
bbh00410  beta-Alanine metabolism
bbh00640  Propanoate metabolism
bbh00650  Butanoate metabolism
bbh00903  Limonene and pinene degradation
bbh00930  Caprolactam degradation
bbh01040  Biosynthesis of unsaturated fatty acids
bbh01100  Metabolic pathways
bbh01110  Biosynthesis of secondary metabolites
bbh01120  Microbial metabolism in diverse environments
bbh01130  Biosynthesis of antibiotics
bbh01200  Carbon metabolism
bbh01212  Fatty acid metabolism
Module
bbh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN112_1721
   00650 Butanoate metabolism
    BN112_1721
  Lipid metabolism
   00071 Fatty acid degradation
    BN112_1721
   01040 Biosynthesis of unsaturated fatty acids
    BN112_1721
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN112_1721
   00310 Lysine degradation
    BN112_1721
   00380 Tryptophan metabolism
    BN112_1721
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN112_1721
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN112_1721
   00281 Geraniol degradation
    BN112_1721
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN112_1721
   00930 Caprolactam degradation
    BN112_1721
Enzymes [BR:bbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BN112_1721
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN112_1721
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BN112_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 AlaDh_PNT_C ApbA UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 13978779
NCBI-ProteinID: YP_006967787
UniProt: A0A0C6P2M8
Position
1866429..1868372
Genome map
AA seq 647 aa AA seqDB search
MNTPDLAYIHWRLHREADGLAWLALARADATANSLSAEVMAELAAVLDALQAQPPNGLVI
LSGKENGFIVGADINEFGALQTPQQARELVARGWQLFNRLAATPYPTLALIRGHCLGGGL
ELALACRYRIAADDADTALGLPEAMLGIFPGWGGMRRLPALIGAPAALDMMLTGRRVDAR
RAAALGLVDARVPPRLLQAAARATVLSGRAPRRARGLPAWLNRWPLKALAARRARQSVAA
KDPQGHYPAPRAIIDIWARHGGNALHAPDLIDGILASDTARQLLRVFRLQERLKGYGKAA
VDAPVRRVHVVGAGVMGGDIAAWCAYRGLTVTLQDQDMARIAPALARAGAFFARKLKDRR
AARAAFDRLVPDPQGDGVAQADLVIEAISENAQAKQALYRQLEPRLKPGALLATNTSSLS
LAGLAQVLDQPQRLVGIHFFNPVARMPLVEVVLAADGDPRALARACAFVGRIGKLPLPVR
DAPGFLVNAVLAPYMLEAMRCVDEGMAPAAIDAAMAAFGMPMGPLELADTVGLDIAAAAG
AQLTGEQAPPRCLAERLARKELGRKSGRGFYAWRDGKAVKPAARGVPPGLVDRLLQPLID
SARERVAAGVVADADLADAGAIFGTGFAPYTGGPLQYASQREAVQRP
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcccgacctggcctacatccactggcgcctgcaccgtgaagccgacggcctg
gcatggctggcgctggcgcgcgccgacgccaccgcgaactcgctgtcggccgaagtcatg
gccgaactcgccgcggtgctcgacgccctgcaggcccagccgcccaacggactggtcatt
ctgtcgggcaaggagaacggcttcatcgtcggcgccgacatcaacgaattcggcgcgctg
cagacgccgcagcaggcgcgcgaactggtcgcgcgcggctggcagctgttcaaccggctg
gcggcgacgccgtaccccacgctggcgctgatacgcggccactgcctgggcggcggcctg
gaactggcgctggcctgccgctaccgcatcgccgccgacgacgccgacaccgcgctgggg
ctgccggaagccatgctgggcattttccccggctggggcggcatgcggcgcctgccggcg
ctgatcggcgcgccggccgcgctggacatgatgctgaccggacgccgggtcgacgcgcgc
cgcgccgcggcgctgggcctggtcgacgcgcgcgtgccgccgcggctgctgcaggccgcc
gcccgcgccaccgtgctgtcgggccgagcgccgcgccgcgcgcgcggcctgccggcctgg
ctgaaccgctggccgctcaaggcgctggcggcgcgccgcgcgcgccagagcgtggccgcc
aaggatccgcagggccactaccccgccccgcgcgccatcatcgacatctgggcgcgccac
ggcggcaacgccctgcatgcgcccgacctgatagacggcatcctggcttcggacacggcg
cgccagctgctgcgcgtgttccgcctgcaggaacggctcaagggctacggcaaggccgcc
gtcgacgcgcccgtgcggcgcgtgcacgtggtgggcgccggcgtcatgggcggcgatatc
gccgcctggtgcgcctaccgcgggttgaccgtcacgctgcaagaccaggacatggcgcgc
atcgcgccggcgctggcgcgcgccggcgccttcttcgcccgcaagctgaaggaccggcgc
gccgcgcgcgccgccttcgaccgcctggttcccgacccccagggcgatggcgtggcgcaa
gccgacctggtcatcgaggccatcagcgagaacgcccaggccaagcaggccctctaccgc
cagctcgaaccgcgcctgaaaccgggcgccctgctggccaccaatacctccagcctgtcg
ctggccgggctggcccaggtcctcgaccagccgcagcggctggtcggcatccatttcttc
aacccggtggcgcgcatgccgctggtcgaagtcgtgctcgccgccgacggcgatccgcgc
gcgctggcgcgggcctgcgccttcgtcggccgcatcggcaagctgccgctgcccgtgcgc
gacgcgccgggtttcctggtcaatgcggtgctggcgccctacatgctggaagcgatgcgc
tgcgtcgacgagggcatggcgccggcggccatcgacgccgccatggccgccttcggcatg
ccgatggggccgctcgagctggccgacaccgtcgggctggacatcgcggcggccgccggc
gcccagctcaccggcgagcaagcgccgccgcgctgcctggccgaacgcctggcgcgcaag
gaactgggccgcaagagcggccgcggcttttatgcctggcgcgacggcaaggcggtcaag
ccggccgcgcgcggcgtgccgccagggctggtcgaccgcctgctccagcccctgatcgac
agcgcccgcgagcgcgtggccgccggcgtggtggccgatgcggacctggccgacgcgggc
gcgattttcggcacgggctttgccccctacacgggcggcccgctgcaatacgcaagtcaa
cgagaagccgtccagcggccttag

DBGET integrated database retrieval system