KEGG   Bordetella bronchiseptica 253: BN112_1923Help
Entry
BN112_1923        CDS       T02344                                 

Gene name
galU2
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BN112_1923 (galU2)
   00052 Galactose metabolism
    BN112_1923 (galU2)
   00500 Starch and sucrose metabolism
    BN112_1923 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    BN112_1923 (galU2)
Enzymes [BR:bbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BN112_1923 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2079074..2079907
Genome map
AA seq 277 aa AA seqDB search
MHTVRKAVFPVAGLGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITELIFVTGRN
KRAIEDHFDRAPELERDLEEKNKLAMLDMVRHVIPPDVKYVYTRQPAALGLGHAVLCAAP
IVGREPFAVLLADDLIDAPRAVIGEMMKVAREFQGSVLALQRVPSRSTSQYGIVAGKTVS
GAIMQVEEIVEKPAPAQAPSDMAVVGRYVLDWRIFAALENTRPGVGGEIQLTDAIATLLD
DPGVFGYAYDGVRYDCGSKEGFYRATMDLGRKYHGMQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgtgcgcaaagctgtctttcccgtcgccggactgggcacgcgattcctgccc
gccaccaaggccatgcccaaggaaatgctgcccgtcgtcgacaagccgctgatccagtac
gccgtcgaggaagccgtggcggccggcatcaccgaactgattttcgtcacgggtcgcaac
aagcgcgccatcgaggatcacttcgaccgggcgccggagctcgagcgcgacctggaagag
aagaacaagctggccatgctcgacatggtgcgccacgtcatcccgcccgacgtcaagtac
gtctacacgcggcaaccggcggccttggggctggggcatgccgtcctgtgcgcggcgccc
atcgtggggcgcgagccgttcgcggtcctgctggccgacgacctgatcgacgcgccgcgc
gcggtcatcggcgagatgatgaaggtcgcgcgcgaattccagggcagcgtgctggccctg
cagcgcgtgccgtcacgcagcaccagccagtacggcatcgtcgcgggcaagacggtatcg
ggcgcgatcatgcaagtggaagagatcgtcgaaaagcccgcgcccgcgcaggcgccctcg
gacatggcggtcgtcggccgctatgtgctggactggcgcatcttcgcggcgctggaaaac
acccgtccgggcgtgggcggcgaaatccagcttaccgatgccatcgccaccctgctggac
gacccgggcgtgttcggctacgcctacgacggcgtgcgctacgactgcggcagcaaggaa
gggttctaccgcgccaccatggacctgggcaggaaataccacggcatgcaatag

DBGET integrated database retrieval system