KEGG   Bordetella bronchiseptica 253: BN112_2019Help
Entry
BN112_2019        CDS       T02344                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bbh03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2183631..2184239)
Genome map
AA seq 202 aa AA seqDB search
MDPQLPEPEPLIALIEALRRLPGVGVRSARRMAYHLLQHDLQGADMLGRALSGAVQHLRH
CARCNSFTEDEVCATCANPKRDPGLLCIVETPADQNMIESSHGYRGLYYVLMGRIAPLEG
VGPRELDFQRVIERACDGVVQEVILATNFTAEGETTAHFLGDALSERGLKVTRLARGVPA
GSELEYVDAGTIAWALMERRST
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggatccccaactccccgaacccgaaccgctgatcgccctgatcgaggcgttgcgccgc
ctgcctggcgtgggcgtgcgctcggcccgccgcatggcctatcacctgctgcagcacgac
ctgcagggggccgacatgctgggccgcgcgctttccggcgccgtgcagcacctgcgccat
tgcgcgcgctgcaacagctttaccgaagacgaggtctgcgcgacctgtgccaatcccaag
cgcgatcccggcctgctgtgcatcgtcgagacgccggccgaccagaacatgatcgagtcc
agccacggctaccgcgggctgtactacgtgctgatgggacgcatcgcgccgctggaaggg
gtgggaccgcgcgagctcgacttccagcgcgtcatcgagcgcgcctgcgacggcgtggtc
caggaagtcatcctggccaccaatttcaccgccgagggcgagacgacggcccacttcctg
ggcgatgccctgagcgagcgcggcctgaaagtcacccggctggcgcgcggcgtgccggcc
ggcagcgagctcgagtatgtcgatgccggcaccattgcctgggccttgatggagcgccgt
tcgacctag

DBGET integrated database retrieval system