KEGG   Bordetella bronchiseptica 253: BN112_2401Help
Entry
BN112_2401        CDS       T02344                                 

Gene name
pepM
Definition
phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    BN112_2401 (pepM)
Enzymes [BR:bbh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     BN112_2401 (pepM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2582819..2583691)
Genome map
AA seq 290 aa AA seqDB search
MTKNRSLRAALESGQLFTAMAAHNPLAARLAEEAGFGGIWGSGFELSASYAVPDANILSM
GTHLEMMRAIAATVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKDTSL
RAEGRQELVRIEEFQGKVAAAAAARKDPDFVVIARVEALIAGQGQDEAIRRGLAYEEAGA
DAILIHSKQKTPDEILAFVAAWPGRKPLVLVPTAYPQLGERDIAALGKVGVVIYGNHAIR
AAVGAMREVFAQIRRDQGIGQADRGLPTVKEIIALQGDARMREIEARYLK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaagaatcgatccctacgcgccgcgctcgaaagcggccagctcttcacggccatg
gccgcgcacaatcccctggcggccaggctggccgaggaggccggattcggcggcatctgg
ggcagcggcttcgagctgtcggccagctacgccgtgccggacgccaacattctttccatg
ggcacgcacctggaaatgatgcgcgccatcgccgcgaccgtgtccatcccgctgatcgcc
gacatcgataccggcttcggcaatgcggtcaacgtgcattacgtggtgccgcagtacgag
gccgcgggcgcttcggccatcgtcatggaggacaagacctttcccaaggacaccagcctg
cgcgccgagggccgccaggaactggtgcgcatcgaggagttccagggcaaggtcgccgcc
gccgcggccgcgcgcaaggaccccgacttcgtcgtgatcgcgcgggtcgaggcgctgatc
gcgggccagggccaggacgaggcgatccggcgcggcctggcctacgaggaagccggcgcg
gacgccattctcatccattccaagcagaagacgcccgacgagatcctggccttcgtcgcc
gcgtggcccggccgcaagcccctggtgctggtgcccaccgcgtacccgcagctgggcgag
cgggatatcgccgcgctgggcaaggtgggcgtggtcatctacggcaaccacgccatccgt
gccgccgtgggcgccatgcgcgaggtcttcgcgcagatccggcgcgaccagggcatcggc
caggccgatcgcggcctgcccacggtcaaggagatcatcgccctgcagggcgatgcgcgc
atgcgcgagatcgaggcccgctacctgaagtag

DBGET integrated database retrieval system