KEGG   Bordetella bronchiseptica 253: BN112_2562Help
Entry
BN112_2562        CDS       T02344                                 

Definition
(RefSeq) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00250  Alanine, aspartate and glutamate metabolism
bbh01100  Metabolic pathways
bbh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN112_2562
Enzymes [BR:bbh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BN112_2562
Peptidases [BR:bbh01002]
 Cysteine Peptidases
  Family C44
   BN112_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-GeneID: 13979620
NCBI-ProteinID: YP_006968616
UniProt: A0A0C6P8N1
Position
complement(2767644..2769569)
Genome map
AA seq 641 aa AA seqDB search
MCGIVGIWGPLRDKANVLAESCRRIRHRGPDSNGYWEDAEADLALAHVRLAILDLTEAGH
QPMVSACGRYVIVLNGEIYNHMELRERLQQDGLAPAWRGHSDTETVLACFAGWGLEQTLQ
AAVGMFAIALWDRAERKLALMRDRMGEKPLYYGYSQANLLFGSELKAFMPVPGFGRELDR
NALASFMRHNYIPAPQSIYAGIRKLPPGAWVEIDAAQMRRGELPEPQVYWSARRAADQGL
GDRRRFESDAQAIDALEQVVSQAVRGQMLSDVSLGAFLSGGIDSSTVVALMQAQSAQPVR
TFAIGFHEKGYNEAEHAKAVAAHLGTEHTELYVTAEDGLAVVPSLADMYDEPFADSSQIP
TSLVTRMARQHVTVALSGDGGDELFGGYSRYFRVDNWWRKCAAMPGPLRHLAGAALRGSA
ALPGAGAWRGKVGKLGELLGADTRGEFYRLFVSYWADPGRVVIGGTEPLSPFEQPMEGST
FDAMMKLDTVTYLPDDILVKVDRAAMAVSLETRVPLIDHRVYEFAWQLPFEYKVRGGTGK
WLLRQLLYRHVPQAMVDRPKRGFAVPLAAWLRGPLRDWAEALLDPARLRQEGWFEPEPIL
RKWREHLSGHRNWDSHLWGVLMMQAWLDRYRAGAGDEAGRR
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgtcggaatctggggtcccttgcgggacaaggccaatgtgctggccgaa
agctgccggcgcatccgccaccgcggccccgacagcaatggctattgggaagacgccgag
gccgacctggcgctggcgcatgtgcgcctggccatcctggacttgaccgaggccggccac
cagcccatggtgtcggcctgcggccgctacgtcatcgttctcaatggcgagatctacaac
cacatggagttgcgcgagcgcctgcagcaggacgggctggcgccggcctggcgcggccac
tccgataccgagacggtgctggcctgcttcgccggctggggcctcgagcagaccctgcag
gccgcggtgggcatgttcgccatcgcgctctgggaccgcgccgagcgcaagctggcgttg
atgcgcgaccgcatgggcgagaaaccgctttactacggctattcgcaggccaacctgctg
ttcggctcggaactcaaggcgttcatgccggtgcccggcttcggccgcgagctcgatcgc
aatgccctggcctcgttcatgcgccacaactacattcccgcgccgcagtcgatctacgcc
ggcatccgcaagctgccgccgggcgcctgggtcgagatcgacgcggcgcagatgcgccgt
ggcgagttgcccgaaccccaggtgtactggtcggcgcgccgcgcggccgaccagggcctg
ggcgaccggcgccgcttcgagtccgacgcgcaggcgatcgacgcgctggagcaggtggtg
tcgcaggcggtgcgtggccagatgctgtcggatgtcagcctgggcgcgtttctttccggc
ggcatcgactcctccaccgtcgtggccctgatgcaggcgcaaagcgcgcagccggtgcgc
accttcgccatcggctttcacgaaaagggctataacgaggccgagcacgccaaggccgtg
gcggcgcacctgggcaccgagcataccgagctctacgtcaccgccgaggatggcctggcc
gtggtgccgtccctggcagacatgtacgacgagccctttgccgactcgtcgcagatcccg
acctcgctggtcacgcgcatggcgcgccagcacgtgacggtggccttgtcgggcgatggc
ggcgacgagctgttcggcgggtattcgcgctatttccgcgtcgacaactggtggcgcaaa
tgcgccgccatgcccgggccgctgcgccatctggcgggcgcggcgctgcgcggctcggcc
gcgctgccgggggccggcgcctggcgcggcaaggtcggcaagctgggcgagctgctcggc
gccgacacgcgcggcgagttctatcgcctgttcgtctcctactgggccgatccgggccgc
gtggtgatcggcggcacggagccactgtcgccgttcgagcagccgatggagggctccacc
ttcgacgccatgatgaagctggacacggtcacctacctgcccgacgacatcctggtcaag
gtcgaccgcgcggcgatggccgtcagcctggagacgcgcgtgccgctgatcgaccatcgc
gtctacgaattcgcctggcagctgccgttcgaatacaaggtgcgcggcggcaccggcaag
tggctgctgcgccagctgctgtaccgccacgtgccgcaggccatggtggatcggcccaag
cgcggcttcgccgtgccgctggccgcctggctgcgcgggccgctgcgcgactgggccgag
gccttgctggacccggcgcgcctgcgccaggaaggctggttcgagcccgagcccatcctg
cgcaaatggcgcgaacacctgtcggggcaccgcaactgggacagccatctgtggggcgtg
ctgatgatgcaggcctggctggaccgctatcgcgccggggccggcgatgaggccggccgc
cgatga

DBGET integrated database retrieval system