KEGG   Bordetella bronchiseptica 253: BN112_2810Help
Entry
BN112_2810        CDS       T02344                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BN112_2810
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BN112_2810
   00650 Butanoate metabolism
    BN112_2810
  Lipid metabolism
   00071 Fatty acid degradation
    BN112_2810
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BN112_2810
   00310 Lysine degradation
    BN112_2810
   00360 Phenylalanine metabolism
    BN112_2810
   00380 Tryptophan metabolism
    BN112_2810
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BN112_2810
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BN112_2810
   00281 Geraniol degradation
    BN112_2810
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BN112_2810
   00627 Aminobenzoate degradation
    BN112_2810
   00930 Caprolactam degradation
    BN112_2810
Enzymes [BR:bbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BN112_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3037634..3038491
Genome map
AA seq 285 aa AA seqDB search
MRRGAMNTHQRYGAVSNMRYEDFEFLLCEPQDDGVMLVTLNRPDAMNATNDRMHWELTRI
WGVVNDDPGVKAAVVTGAGERAFSAGGDLSVVEAMSNSHETTMRVMKEASDIVYNMLACD
KPIISAINGTAVGAGLAVALLADVSVMAEDAKLTDGHARLGVSAGDHAAIIWPILCGMSK
AKYYLMTADFVDGKEAERIGLVTFCAPRAEVLPRSLAIAAKLARGSQTAIRATKKSLNNW
MRTAGPAFDNSLALEMLCFLGPDVKEGLAALRDKRAPDFPSARLP
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgtggcgcaatgaatacgcatcaacgctatggagccgtatcgaacatgcgctac
gaagactttgaattcctgctgtgcgaaccccaggacgacggcgtcatgctggtcacgctc
aaccggcccgacgccatgaacgccaccaacgaccgcatgcactgggaactgacccggatc
tggggcgtcgtcaacgacgaccctggcgtcaaggcggccgtggtcaccggcgccggcgag
cgggcgttctcggccggcggcgacctgtccgtcgtggaggccatgtccaacagccacgaa
accaccatgcgggtcatgaaagaggcctccgacatcgtctacaacatgctggcctgcgac
aagccgatcatttccgcgatcaacggcacagccgtgggcgccggcctggccgtggccctg
ctggccgatgtgagcgtcatggccgaggatgcgaagctgaccgacgggcacgcccggctg
ggcgtctcggccggagaccatgccgccatcatctggccgattctctgcggcatgtccaag
gcgaagtactacctgatgaccgcggacttcgtcgacggcaaggaagccgaacgcatcggg
ctggtgacgttctgcgcgccacgcgccgaggtcctgcccaggtcgctcgcgattgccgcg
aagctggcgcggggcagccagacagccatccgcgcgaccaagaagtcgctcaacaactgg
atgcgcaccgccggccccgccttcgacaattcgctggcgctggagatgctgtgcttcctg
ggcccggacgtcaaggaaggattggccgcgctgcgcgacaagcgcgcgcccgattttccc
tcggcgcgcctgccctga

DBGET integrated database retrieval system