KEGG   Bordetella bronchiseptica 253: BN112_3317Help
Entry
BN112_3317        CDS       T02344                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN112_3317 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BN112_3317 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    BN112_3317 (glcB)
Enzymes [BR:bbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BN112_3317 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3584823..3587000
Genome map
AA seq 725 aa AA seqDB search
MTERIPHHGLQVAASLHRFIEDEALSGSGLAPDEFWAGFAALVRDLAPRNRELLAERDRL
QGEIDAWHRAHPGPVRDSAGYQALLERIGYLQPQPAQVTASTRDVDSEIASQAGPQLVVP
VSNARYALNAANARWGSLYDALYGTDAIPPVAGDDGKGYNPARGEAVIARARAFLDEAAP
LAQGSHADATAYAIEGGKLAVTLGAGQRTGLRNPAQLAGYQGDASQPAAVLLANNGLHFE
IQIDRQHQIGATDAAGVKDVLLEAALTTIMDCEDSVAAVDADDKVLIYRNWLGLMKGDLS
ESVTKGGKTFTRRLNADRQYHKPDGGTLTLHGRSLMFVRNVGHLMTNPAILDEQGNEVPE
GILDAVITSLAALPDRANRLNSRTGSIYIVKPKMHGPAEAAFANELFDRVEDLLKLPRHT
IKMGIMDEERRTSVNLKACIAAAAARVAFINTGFLDRTGDEMHTGMEAGPMLRKGDMKSS
AWITAYERNNVLVGLDCGLRGRAQIGKGMWAMPDMMAAMLEQKIGHPKAGANTAWVPSPT
AATLHAMHYHQVDVAAVQQALEQTRYDSVRDELLAGLLTVPVGDPAAWSADDIQRELDNN
AQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLRHGIVDRAQVNAT
FERMAKVVDQQNAGDPNYLPMAGHFDTSFAYRAACALVFEGLTQPNGYTEPLLHEYRQAF
KAAQR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcatcccgcatcatggcctgcaagtggcggcctccctgcaccgtttcatc
gaagacgaggcgttgtccggcagcggcctggcgcccgacgagttctgggccggcttcgcc
gccctggtgcgcgacctcgcgccgcgcaaccgcgaactgctggccgagcgcgaccgcctg
cagggcgaaatcgacgcctggcaccgcgcccatcccggccccgtgcgcgacagcgccggg
tatcaggcgctgctcgaacgcatcggctacctgcagccccagccagcacaggtgaccgcc
agtacccgcgacgtggacagcgagatcgccagccaggccggcccgcagctggtggttccc
gtctccaacgcgcgctatgcgctgaacgcggccaacgcccgctggggcagcctgtacgac
gcgctctatggcaccgacgcgatcccgccggtggccggcgatgacggcaagggctacaac
ccggcgcgcggcgaagccgtgatcgcccgcgcgcgcgccttcctggacgaggcggcgccg
ctggcccagggttcgcacgccgacgccaccgcctacgccatcgagggtggcaagctggcg
gtcacgctgggcgccggccagcgcacgggcctgcgcaaccccgcgcaactggccggctat
cagggcgatgcctcgcaaccggccgccgtgctgctggccaacaacggcctgcacttcgaa
atccagatcgaccgccagcaccagatcggcgccaccgatgccgccggcgtcaaggacgtg
ctgctcgaggccgccctgaccaccatcatggattgcgaagactccgtggcggccgtcgat
gccgacgacaaggtactgatctaccgcaactggctcgggctcatgaagggcgacctgagc
gaatcggtcaccaagggcggcaagaccttcacccgccgcctgaacgccgaccgccagtac
cacaagcccgacggcggcaccctgacgctgcacggccgctcgttgatgttcgtgcgcaac
gtcggccacctgatgaccaacccggccatcctcgacgagcagggcaatgaagtgccggaa
ggcatcctcgatgcggtgatcaccagcctggccgccctgcccgaccgcgccaaccggctc
aactcgcgcaccggctcgatctacatcgtcaagcccaagatgcacggaccggccgaggcc
gccttcgccaacgagttgttcgaccgcgtcgaggacctgctcaagctgccgcgccacacc
atcaagatgggcatcatggacgaagagcggcgcaccagcgtcaacctgaaggcctgcatc
gcggccgcggcggcgcgcgtggctttcatcaacaccgggttcctggaccgcaccggcgac
gaaatgcataccggcatggaagccggcccgatgctgcgcaagggcgatatgaaatccagc
gcctggatcaccgcctacgagcgcaacaacgtgctggtcgggctggactgcggcctgcgc
gggcgcgcccagatcggcaagggcatgtgggccatgcccgacatgatggcggccatgctc
gaacagaagatcggccaccccaaggcgggcgccaacacggcctgggtgccctcgcccacg
gccgcgaccctgcacgccatgcactatcaccaggtcgacgtcgcggccgtgcagcaggcg
ctggagcagacccgctacgacagcgtgcgcgacgagctgctggccggcctgctgaccgtc
ccggtaggcgatccggccgcctggtcggccgatgacatccagcgcgagctcgacaacaac
gcccagggcatcctgggctacgtggtgcgctggatcgaccagggcgtgggatgctcgaag
gtgcccgacatcaacaacgtcggcctgatggaagaccgcgccaccctgcgcatctccagc
cagcacatcgccaactggctgcgccacggcatcgtcgaccgcgcacaggtcaacgccacg
ttcgaacgcatggccaaggtcgtcgaccagcaaaacgccggcgatcccaactacctgccc
atggccggccacttcgacacctcgttcgcctaccgcgcggcgtgcgcgttggtcttcgag
ggcctgacccagcccaacggctacaccgagcccctgctgcacgagtaccggcaagccttc
aaggcggcccagcgctga

DBGET integrated database retrieval system