KEGG   Bordetella bronchiseptica 253: BN112_3576Help
Entry
BN112_3576        CDS       T02344                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bbh01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bbh00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3850703..3852025)
Genome map
AA seq 440 aa AA seqDB search
MQYHDAMALINRLDSRDPGFKTALSQLLAFEAEQDESIDQAAAGILADVRRRGDAALLEY
TQRFDRLAVDDATALEIPQADWHAALDSLPAAQRQALEAAAARVRAYHERQRGETWTYTE
ADGTMLGQQITALDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVPELIMVTPTPDGVRNPI
VLAAAAIAGVDRAFAIGGAQAVGALAYGTATVPAVDKIVGPGNAYVAAAKRRVFGTVGID
MIAGPSEILVICDGKTPADWIAMDLFSQAEHDELAQSILLCPDAAFLAEVEAAIERLLPG
MPRADILRVSLANRGALILVRDLEEACAIANDIAPEHLEISTEQPQRWTALIRHAGAIFM
GRYSSEALGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIQVSREGAQTLGRIAAEL
ALGEGLQAHAASAQYRLDQP
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgcagtaccatgacgccatggccttgatcaatcgtctcgactcccgcgatcccgggttc
aaaaccgccctgtcccaattgctggccttcgaggccgagcaggacgaatccatcgaccag
gccgccgccggcatcctggccgacgtgcgccgccgcggcgacgccgcgctgctcgaatac
acccagcgcttcgaccgcctggccgtcgacgacgccacggccctggaaatcccccaggcc
gattggcatgcggcgctggattcgctgccggccgcccagcgccaggcgctggaagccgcc
gccgcgcgcgtgcgcgcctatcacgagcgccagcgcggcgagacctggacctacaccgag
gccgacggcaccatgctgggccagcagatcacggcgctggaccgcgtcggcctgtacgtg
cccggcggcaaggccgcctatccgtcgtcggtgctgatgaacgccattccggccaaggtt
gccggcgtgcccgagctgatcatggtcacgcccacgccggacggcgtgcgcaaccccatc
gtgctggccgccgccgccatcgccggcgtggaccgcgccttcgccatcggcggcgcccag
gccgtcggcgcgctggcctacggcaccgccacggtgccggcggtcgacaagatcgtcggc
ccgggcaacgcctatgtcgccgccgccaagcggcgcgtcttcggcaccgtcggcatcgac
atgatcgccggcccgagcgaaatcctggtgatctgcgacggcaagacgccggccgactgg
atcgccatggacctgttctcgcaggccgagcacgacgaactggcccagtccatcctgctc
tgtcccgacgccgccttcctggccgaggtcgaggccgccatcgaacgcctgctgccgggc
atgccgcgcgccgacatcctgcgcgtcagcctggccaaccgcggcgcgctcatcctggtg
cgcgacctcgaagaggcctgcgccatcgccaacgacatcgcccccgaacacctggagatc
tccaccgagcagccgcagcgctggaccgccctgatccgccacgcgggcgcgatcttcatg
ggccgctacagctcggaggcgctgggcgactactgcgccggccccaaccacgtcctgccg
acctcgcgcacggcgcgcttctcgtcgccgctgggcgtgtacgacttccagaagcgctcc
agcctgatccaggtctcgcgcgagggcgcccagacgctggggcgcatcgccgccgaactg
gccctgggcgaaggcctgcaggcccacgccgccagcgcccagtaccggctcgaccagcca
tga

DBGET integrated database retrieval system