KEGG   Bordetella bronchiseptica 253: BN112_3720Help
Entry
BN112_3720        CDS       T02344                                 

Definition
2-oxo acid dehydrogenases acyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bbh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bbh00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bbh00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bbh00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4003344..4004585
Genome map
AA seq 413 aa AA seqDB search
MSQLNDLLMPKLGLTMTEGMLIEWSVTSGAEVKAGDSLFVVETDKVANEIVAQADGTLAE
ILVAAGETVPVGTVVARWTGPGQGADDLADAPPAPAPQPAAEAAPAAAREPARGGRVVAT
PLARRLAREAGLDLAQVSGSGPGGRIKAADVRQAPPALPVAPRDAASPAPAARASLTPAA
GEQRIEASALVQSMARRMTQAKQVPHFYLSAEAEVSALLALRQRLNAQADAPRLTLNHFV
IAAVARALAAMPHQNRIWNDDHIVQFQGIDVGVAVSTERGLMAPVLHGLDHASLDDIAAQ
SGALLGRVRAGKATREDMSGGAISISNAGMFNVTYMAPIINPPQSAILGVGSIRELFRPD
EQGAPALRREMGLVLAADHRLHDGASALAFLNHVIDLLQDPYRLLRNRPHTKG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttgaacgacctgctcatgcccaagctgggcctgaccatgaccgaaggcatg
ctgatcgagtggagcgtgaccagcggcgccgaggtcaaggcgggcgattcgctgttcgtg
gtggagacggacaaggtcgccaacgagattgtcgcgcaggccgacggcacgctggccgag
atcctggtcgccgccggcgagacggtgccggtgggcaccgtggtggcgcgctggaccggg
cccggccagggcgcggacgacctggccgacgcgccgccggcgccggcgccgcagccggcc
gccgaggccgcgccggccgcggcgcgcgaacccgcgcgcggcgggcgcgtcgtggccacg
ccgctggcgcggcgcctggcgcgcgaagccggcctggacctggcgcaggtcagcggttcc
gggccgggcggacgcatcaaggccgccgacgtgcgccaggccccgccggccttgccggtt
gcgccgcgggatgcggcttcgcctgcgccagccgcgcgcgcgtcgttgacgcctgccgcc
ggcgaacagcgcatcgaggccagcgcgctggtgcagtccatggcccggcgcatgacgcag
gccaagcaggtgccgcatttctacctctcggccgaggccgaggtcagcgcgctgctggcg
ctgcgccagcgcctgaacgcgcaggccgacgcgccgcggctgacgctcaaccacttcgtc
atcgcggcggtggcgcgcgcgctggcggccatgccgcaccagaaccgcatctggaacgac
gaccacatcgtccagttccagggcatcgacgtgggcgtggcggtctcgaccgagcgcggc
ctgatggcgccggtgctccacgggctggaccatgcctcgctggacgacatcgccgcgcaa
tccggcgccctgctgggccgggtgcgcgccggcaaggccacccgcgaagacatgagcggg
ggcgcgatttccatttccaacgccggcatgttcaacgtgacatacatggcgcccatcatc
aacccgccgcaatcggccattctcggcgtgggcagcatacgcgagctgttccggcccgac
gagcagggcgccccggcgctgcggcgcgagatgggcctggtgctggccgccgaccaccgg
ctgcacgacggcgccagcgcgctggcgttcctcaatcacgtcatcgacctgctgcaagac
ccgtaccggctgttgcgcaaccgaccccataccaaaggatag

DBGET integrated database retrieval system