KEGG   Bordetella bronchiseptica 253: BN112_3720Help
Entry
BN112_3720        CDS       T02344                                 

Definition
(RefSeq) 2-oxo acid dehydrogenases acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00010  Glycolysis / Gluconeogenesis
bbh00020  Citrate cycle (TCA cycle)
bbh00620  Pyruvate metabolism
bbh01100  Metabolic pathways
bbh01110  Biosynthesis of secondary metabolites
bbh01120  Microbial metabolism in diverse environments
bbh01130  Biosynthesis of antibiotics
bbh01200  Carbon metabolism
Module
bbh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN112_3720
   00020 Citrate cycle (TCA cycle)
    BN112_3720
   00620 Pyruvate metabolism
    BN112_3720
Enzymes [BR:bbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN112_3720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 13980775
NCBI-ProteinID: YP_006969757
UniProt: A0A0C6PBX1
Position
4003344..4004585
Genome map
AA seq 413 aa AA seqDB search
MSQLNDLLMPKLGLTMTEGMLIEWSVTSGAEVKAGDSLFVVETDKVANEIVAQADGTLAE
ILVAAGETVPVGTVVARWTGPGQGADDLADAPPAPAPQPAAEAAPAAAREPARGGRVVAT
PLARRLAREAGLDLAQVSGSGPGGRIKAADVRQAPPALPVAPRDAASPAPAARASLTPAA
GEQRIEASALVQSMARRMTQAKQVPHFYLSAEAEVSALLALRQRLNAQADAPRLTLNHFV
IAAVARALAAMPHQNRIWNDDHIVQFQGIDVGVAVSTERGLMAPVLHGLDHASLDDIAAQ
SGALLGRVRAGKATREDMSGGAISISNAGMFNVTYMAPIINPPQSAILGVGSIRELFRPD
EQGAPALRREMGLVLAADHRLHDGASALAFLNHVIDLLQDPYRLLRNRPHTKG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttgaacgacctgctcatgcccaagctgggcctgaccatgaccgaaggcatg
ctgatcgagtggagcgtgaccagcggcgccgaggtcaaggcgggcgattcgctgttcgtg
gtggagacggacaaggtcgccaacgagattgtcgcgcaggccgacggcacgctggccgag
atcctggtcgccgccggcgagacggtgccggtgggcaccgtggtggcgcgctggaccggg
cccggccagggcgcggacgacctggccgacgcgccgccggcgccggcgccgcagccggcc
gccgaggccgcgccggccgcggcgcgcgaacccgcgcgcggcgggcgcgtcgtggccacg
ccgctggcgcggcgcctggcgcgcgaagccggcctggacctggcgcaggtcagcggttcc
gggccgggcggacgcatcaaggccgccgacgtgcgccaggccccgccggccttgccggtt
gcgccgcgggatgcggcttcgcctgcgccagccgcgcgcgcgtcgttgacgcctgccgcc
ggcgaacagcgcatcgaggccagcgcgctggtgcagtccatggcccggcgcatgacgcag
gccaagcaggtgccgcatttctacctctcggccgaggccgaggtcagcgcgctgctggcg
ctgcgccagcgcctgaacgcgcaggccgacgcgccgcggctgacgctcaaccacttcgtc
atcgcggcggtggcgcgcgcgctggcggccatgccgcaccagaaccgcatctggaacgac
gaccacatcgtccagttccagggcatcgacgtgggcgtggcggtctcgaccgagcgcggc
ctgatggcgccggtgctccacgggctggaccatgcctcgctggacgacatcgccgcgcaa
tccggcgccctgctgggccgggtgcgcgccggcaaggccacccgcgaagacatgagcggg
ggcgcgatttccatttccaacgccggcatgttcaacgtgacatacatggcgcccatcatc
aacccgccgcaatcggccattctcggcgtgggcagcatacgcgagctgttccggcccgac
gagcagggcgccccggcgctgcggcgcgagatgggcctggtgctggccgccgaccaccgg
ctgcacgacggcgccagcgcgctggcgttcctcaatcacgtcatcgacctgctgcaagac
ccgtaccggctgttgcgcaaccgaccccataccaaaggatag

DBGET integrated database retrieval system