KEGG   Bordetella bronchiseptica 253: BN112_3720Help
Entry
BN112_3720        CDS       T02344                                 

Definition
2-oxo acid dehydrogenases acyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN112_3720
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN112_3720
   00020 Citrate cycle (TCA cycle)
    BN112_3720
   00620 Pyruvate metabolism
    BN112_3720
Enzymes [BR:bbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BN112_3720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4003344..4004585
Genome map
AA seq 413 aa AA seqDB search
MSQLNDLLMPKLGLTMTEGMLIEWSVTSGAEVKAGDSLFVVETDKVANEIVAQADGTLAE
ILVAAGETVPVGTVVARWTGPGQGADDLADAPPAPAPQPAAEAAPAAAREPARGGRVVAT
PLARRLAREAGLDLAQVSGSGPGGRIKAADVRQAPPALPVAPRDAASPAPAARASLTPAA
GEQRIEASALVQSMARRMTQAKQVPHFYLSAEAEVSALLALRQRLNAQADAPRLTLNHFV
IAAVARALAAMPHQNRIWNDDHIVQFQGIDVGVAVSTERGLMAPVLHGLDHASLDDIAAQ
SGALLGRVRAGKATREDMSGGAISISNAGMFNVTYMAPIINPPQSAILGVGSIRELFRPD
EQGAPALRREMGLVLAADHRLHDGASALAFLNHVIDLLQDPYRLLRNRPHTKG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgagccagttgaacgacctgctcatgcccaagctgggcctgaccatgaccgaaggcatg
ctgatcgagtggagcgtgaccagcggcgccgaggtcaaggcgggcgattcgctgttcgtg
gtggagacggacaaggtcgccaacgagattgtcgcgcaggccgacggcacgctggccgag
atcctggtcgccgccggcgagacggtgccggtgggcaccgtggtggcgcgctggaccggg
cccggccagggcgcggacgacctggccgacgcgccgccggcgccggcgccgcagccggcc
gccgaggccgcgccggccgcggcgcgcgaacccgcgcgcggcgggcgcgtcgtggccacg
ccgctggcgcggcgcctggcgcgcgaagccggcctggacctggcgcaggtcagcggttcc
gggccgggcggacgcatcaaggccgccgacgtgcgccaggccccgccggccttgccggtt
gcgccgcgggatgcggcttcgcctgcgccagccgcgcgcgcgtcgttgacgcctgccgcc
ggcgaacagcgcatcgaggccagcgcgctggtgcagtccatggcccggcgcatgacgcag
gccaagcaggtgccgcatttctacctctcggccgaggccgaggtcagcgcgctgctggcg
ctgcgccagcgcctgaacgcgcaggccgacgcgccgcggctgacgctcaaccacttcgtc
atcgcggcggtggcgcgcgcgctggcggccatgccgcaccagaaccgcatctggaacgac
gaccacatcgtccagttccagggcatcgacgtgggcgtggcggtctcgaccgagcgcggc
ctgatggcgccggtgctccacgggctggaccatgcctcgctggacgacatcgccgcgcaa
tccggcgccctgctgggccgggtgcgcgccggcaaggccacccgcgaagacatgagcggg
ggcgcgatttccatttccaacgccggcatgttcaacgtgacatacatggcgcccatcatc
aacccgccgcaatcggccattctcggcgtgggcagcatacgcgagctgttccggcccgac
gagcagggcgccccggcgctgcggcgcgagatgggcctggtgctggccgccgaccaccgg
ctgcacgacggcgccagcgcgctggcgttcctcaatcacgtcatcgacctgctgcaagac
ccgtaccggctgttgcgcaaccgaccccataccaaaggatag

DBGET integrated database retrieval system