KEGG   Bordetella bronchiseptica 253: BN112_4019Help
Entry
BN112_4019        CDS       T02344                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bbh00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bbh00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4317170..4318123
Genome map
AA seq 317 aa AA seqDB search
MLNPQLNRHGELIHLLSTEGLPRRIIEQILDLAATFVPAPGQEFPKLPLLHGKSVFNLFF
ENSTRTRTTFEIAAKRLSADVVNLNIAASSTSKGESLLDTIANLSAMQADLFVVRHGASG
APYLIAQHVAPHVHVINAGDGRHAHPTQALLDMYTIRHHKGDFNQLTVAIVGDVLHSRVA
RSDIHALTTLGVPEVRVVAPATLLPEGLAQMGVRVCTDMEEGLCDADVVIMLRLQNERMR
GALLPSAHEYFKHYGLTQARLALARPDAIVMHPGPMNRGVEIASEVADSGQAVILDQVTF
GIAVRMAAMSLVAGVRP
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatccccaactcaatcgccacggcgagctgatccacctgctgtccaccgaaggc
ctgccgcgccgcatcatcgagcagatcctcgacctggccgccaccttcgtgccggcgccc
ggacaggaattccccaagctgcccctgctgcacggcaaaagcgtgttcaacctgttcttc
gagaactccacccgcacgcgtaccaccttcgagatcgccgccaagcgcctgtcggccgac
gtggtcaacctgaacatcgccgcctcgtccacgtccaagggcgaatccctgctcgatacc
atcgccaacctgtcggccatgcaggccgacctgttcgtggtgcgccacggcgccagcggc
gcgccgtacctgatcgcgcagcacgtggcgccccatgtccatgtcatcaacgccggcgac
ggccgccatgcgcatcccacgcaggccttgctggacatgtacaccatccgtcaccacaag
ggcgatttcaaccagctgacggtggccatcgtcggcgacgtactgcattcgcgcgtggcg
cgctccgacatccacgccctgaccacgctgggcgtgcccgaagtgcgcgtggtggcgccg
gccacgctgctgcccgaggggctggcgcagatgggcgtgcgcgtctgtaccgacatggaa
gaagggctgtgcgacgccgacgtcgtcatcatgctgcgcctgcagaacgaacgcatgcgc
ggcgcgctgctgccgtcggcgcacgaatacttcaagcactatggcctgacgcaggcccgc
ctggcgctggcccggcccgacgccatcgtgatgcacccggggccgatgaaccgcggcgtc
gagatcgcctccgaggtggccgacagcggccaggccgtgatactggaccaggtgacattc
ggcatcgcggtgcgcatggccgccatgagcctggtcgcgggagtacggccatga

DBGET integrated database retrieval system