KEGG   Bordetella bronchiseptica 253: BN112_4400Help
Entry
BN112_4400        CDS       T02344                                 

Gene name
ruvA
Definition
(RefSeq) holliday junction DNA helicase
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BN112_4400 (ruvA)
Enzymes [BR:bbh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BN112_4400 (ruvA)
DNA repair and recombination proteins [BR:bbh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BN112_4400 (ruvA)
    RecFOR pathway proteins
     BN112_4400 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_8 5_3_exonuc HHH_3 Transposase_20 Cdd1
Motif
Other DBs
NCBI-GeneID: 13981455
NCBI-ProteinID: YP_006970434
UniProt: A0A0C6PD92
Position
complement(4739596..4740168)
Genome map
AA seq 190 aa AA seqDB search
MIGRITGTLIEKSPPVVCVDVNGVGYEIDVPMSTLYALPETGARVTLFTHLVVREDAQLL
YGFGSSAERSTFRELIKVTGIGARTALAVLSGLSVAELSQAITLQETGRLTRVPGIGKKT
AERLLLEMRGKLGADIGATPHAASGHQSDILNALLALGYSDKESQAALKKLPDGVDVSEG
IRLALKALVR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgcattaccggaaccctcatcgagaaatcgccgcccgtcgtctgtgtcgac
gtcaacggagtgggctatgaaatcgatgtccccatgagcaccctgtatgcgctgcccgag
accggcgcgcgggtcaccctgttcacccacctggtggtgcgcgaggatgcgcagctgctg
tacgggttcggcagcagcgccgagcgcagcacgttccgcgagctgatcaaggtgaccggc
atcggcgcacgcaccgcgctggcggtcctgtcggggctctcggtggccgagctgtcgcag
gccatcacgctgcaggagaccgggcgcctgacgcgcgtgccgggcatcggcaagaagacc
gcggagcgcctgctgctggagatgcgcggcaagctgggcgcggacatcggcgccaccccg
cacgcggccagcggccaccagagcgatatcctcaacgcgctgctggcgctgggctactcc
gacaaggaatcccaggcggcgctcaagaagctgcccgacggggtggacgtgtcggaaggc
atccgcctggcgctcaaggccctggtccgctag

DBGET integrated database retrieval system