KEGG   Bordetella bronchiseptica 253: BN112_4673Help
Entry
BN112_4673        CDS       T02344                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BN112_4673
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN112_4673
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BN112_4673
Enzymes [BR:bbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BN112_4673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(5040658..5041758)
Genome map
AA seq 366 aa AA seqDB search
MLMNPSLSRLRCLRCAHAMPPGDYPEGCPRCLAAGYPASLACEYEPADTAPMPLPVLAPI
TLGEGRTPCLDAPSLAHAHGVARVWLKCESGNPTGSHKDRMAAQLVSRAVLAGADRLAAA
SSGNAGVALAAYGAAAGLRVDIAIAPTCPPRQRAAMEQFGARLHSFADSLARWPYVAALC
RDEGAFAGTNYLNPPVGTHPYGVEGYKPIAAELAMQCDDLPTDIIVPTARGDLLWGICLG
WQELLRRGAIARLPRLHAVEPYPRLAHALAAGDARGVWEQPTAQYSIAGGTVTLQSMQAL
ARSGGQAVDVADEQAARARAALGALGIAAELSSAAALAAVAALKAAGTLDAESRVALILT
SDGRRD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctgatgaacccctcgctgtcccgcctgcgctgcctgcgctgcgcccacgccatgccg
cccggcgactatccggaaggctgtccccgctgcctggcggccggctatccggcctcgctg
gcatgcgaatacgaaccggccgatacggccccgatgcccctgccggttcttgcgccgatc
acgctgggcgagggccgcacgccctgcctcgatgcgccatcgctggcgcatgcgcacggc
gtggcgcgggtctggctgaaatgcgaaagcggcaacccgacaggcagccacaaggaccgc
atggccgcgcaactggtgtcgcgcgcggtgctggccggggccgaccggctggcggccgcc
tccagcggcaacgccggcgtggccctggcggcctacggggccgccgccggcctgcgcgtg
gacatcgccatcgcgcccacctgcccgccgcggcaacgcgccgccatggagcagttcggc
gcgcggttgcacagctttgcagacagcctggcgcgctggccctacgtggcggcgctatgc
cgcgacgagggcgcgttcgccggcaccaactatctcaacccgccggtcggcacccatccc
tacggcgtggagggctacaagccgatcgccgccgaactcgcgatgcagtgcgatgatctt
cccacggacatcatcgtgcccactgcccggggcgatctgctatggggcatctgcctgggc
tggcaggaactgctgcggcgcggcgcgatcgcgcggctgccgcgcctgcatgcggtggaa
ccctatccccgcctggcgcacgcgttggcagccggcgatgcgcgcggcgtatgggagcaa
ccgacggcgcagtactccattgccggcggcacggtgaccctgcaatcgatgcaagccctg
gcgcgcagcggcggacaggcggtggacgtcgcggacgagcaggccgcgcgggcccgcgcg
gcgctgggcgcgctgggcattgccgccgagctgtcgtcggccgcggcgcttgccgccgtg
gcggccctcaaggccgccggcacgctggacgccgaatcgcgcgtggcgctgatcctgacc
tcggacgggcggcgcgactaa

DBGET integrated database retrieval system