KEGG   Bordetella bronchiseptica 253: BN112_4735Help
Entry
BN112_4735        CDS       T02344                                 

Gene name
sdhD
Definition
(RefSeq) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bbh  Bordetella bronchiseptica 253
Pathway
bbh00020  Citrate cycle (TCA cycle)
bbh00190  Oxidative phosphorylation
bbh00650  Butanoate metabolism
bbh01100  Metabolic pathways
bbh01110  Biosynthesis of secondary metabolites
bbh01120  Microbial metabolism in diverse environments
bbh01130  Biosynthesis of antibiotics
bbh01200  Carbon metabolism
Module
bbh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bbh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bbh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bbh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN112_4735 (sdhD)
   00650 Butanoate metabolism
    BN112_4735 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BN112_4735 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Bap31 CybS
Motif
Other DBs
NCBI-GeneID: 13981791
NCBI-ProteinID: YP_006970765
UniProt: A0A0C6PDB2
Position
5106932..5107315
Genome map
AA seq 127 aa AA seqDB search
MADTKNYGPKRLVVGAHYGVTDFIAQRITAVILAVYTLVLIVGLLIMPAFTYENWKALFT
FHVFALPVGQILASLAFFALAWHAWIGVRDIWMDYVRPVGVRLLLQVLTILWLVGSVVYF
AQILWRI
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgaaaaactatggccccaagcgcctggtcgttggcgcccactacggggtt
accgatttcatcgcccagcgcatcaccgccgtcatcctggccgtgtataccctggtgctg
atcgtcggcctgctgatcatgccggctttcacgtatgaaaactggaaggcgctgttcacc
ttccacgtgttcgcccttccggtgggccagatcctggcctcgctcgctttctttgcgctg
gcctggcatgcctggatcggcgtgcgcgacatctggatggactatgtccgcccggtaggc
gtgcgcctgctgctgcaggtgctgaccatcctctggctggtcggttcggtcgtctacttc
gcgcaaatcctctggagaatctaa

DBGET integrated database retrieval system