KEGG   Bordetella bronchiseptica 253: BN112_4748Help
Entry
BN112_4748        CDS       T02344                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase complex, E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bbh  Bordetella bronchiseptica 253
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:bbh01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bbh00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bbh00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5125095..5126315
Genome map
AA seq 406 aa AA seqDB search
MAITDVLVPQLSESVSEATLLTWKKQAGAAVEADEILIEIETDKVVLEVPAPSSGVLSEI
VKGDGSTVTSGEVIARIDTAAKAAAAPAAAEAPAAAPAAAAPAAAAPAAASSAASGVASP
AAAKILAEKGVDAASVAGTGRDGRVTKGDALAAGSAPAAKAAAPVAPPTLSLDGRPEQRV
PMSRLRARIAERLLQSQAENAILTTFNEVNMQAVMDLRARYKDKFEKEHGVKLGFMSFFV
KAAVAALKKYPVLNASVDGKDIIYHGYFDIGIAVGTPRGLVVPILRNADQLTIAEIEKTI
ADFGKRAADGKLGIEEMTGGTFSISNGGVFGSMLSTPIINPPQAAILGIHATKERPVVEN
GQIVIRPINYLAMSYDHRIIDGREAVLGLVAMKEALEDPQRLLLDL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctattaccgacgttctcgtccctcaactgtccgaatcggtttcggaagccacgctg
ctgacctggaagaagcaggcgggcgccgcggtcgaggccgacgaaatcctgatcgaaatc
gagaccgacaaggtggtgctggaagtgccggccccgtcctcgggcgtgctgtccgaaatc
gtcaagggtgacggcagcacggtgacctcgggcgaagtcattgcccgcatcgacacggcc
gccaaggctgccgcggcgcccgccgccgccgaagcgccggccgccgcgccggccgccgcc
gctcccgccgcggccgcgcccgccgcggccagcagcgccgccagcggcgtggcctcgccg
gccgccgccaagatcctcgccgagaagggcgtggacgccgccagcgtggccggcaccggc
cgcgacggccgcgtcaccaagggcgacgccctggctgcgggcagcgcgcccgccgccaag
gccgccgcgccggtggcgccgcccacgctgtcgctggacggccgccccgagcagcgcgtg
ccgatgagccgcctgcgcgcccgcatcgccgagcgcctgctgcaatcgcaagccgagaac
gccatcctgacgacgttcaacgaagtcaacatgcaggccgtgatggacctgcgcgcccgc
tacaaggacaagttcgagaaggagcacggcgtcaagctgggcttcatgtcgttcttcgtt
aaggccgcagttgccgcgctgaagaagtatccggtgctcaacgcctcggtcgacggcaag
gacatcatctaccacggctacttcgacatcggcatcgccgtcggcaccccgcgtggcctg
gtggtgcccatcctgcgcaacgccgaccagctgaccatcgccgagatcgagaagaccatc
gccgacttcggcaagcgcgccgcggacggcaagctgggcatcgaggaaatgaccggcggc
acgttctcgatctccaacggcggggtgttcggctcgatgctgtccacgcccatcatcaac
ccgccgcaggcggccatcctgggcatccacgccaccaaggaacgcccggtggtggagaac
ggccagatcgtcatccggccgatcaactacctggcaatgtcctatgaccaccgcatcatc
gacggccgcgaagccgtgctgggcctggtggccatgaaggaagcgctggaagacccgcaa
cgcctgttgctggatctgtaa

DBGET integrated database retrieval system